KEGG   Photorhabdus asymbiotica: PAU_03218Help
Entry
PAU_03218         CDS       T00941                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00330  Arginine and proline metabolism
pay00332  Carbapenem biosynthesis
pay01100  Metabolic pathways
pay01130  Biosynthesis of antibiotics
pay01230  Biosynthesis of amino acids
Module
pay_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PAU_03218
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PAU_03218
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PAU_03218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAQ85306
UniProt: C7BHW4
Position
complement(3793814..3794989)
Genome map
AA seq 391 aa AA seqDB search
MALCFSPVKTEHCFLQIKYNGRNMMNSSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCA
QQHEKGHRIIIVTSGAIAAGREHLGYPDLPATIASKQLLAAVGQSRLIQLWEQLFSIYGI
HVGQMLLTRADLEDRERFLNARDTLHALLDNRIVPVINENDAVATAEIKVGDNDNLSALA
AILGGADKLLLLTDIEGLYTADPRSNPNAELIPEVYDISDELRMAAGDSVSGLGTGGMAT
KLQAAGIAGRAGIDVIVAAGSKSNVISDVIEGNPVGTRFHGLASPMENRKRWIFGAPPAG
EIIVDHGAGTAICEKGSSLLPKGIKNIKGNFSRGEVICIRSLSGRDLARGVSRYNSDALR
LIAGHHSQQISQILGYEYGAVAVHRDDMIVS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttggcattatgcttttctcctgttaaaactgaacactgttttcttcaaattaaatataac
ggcagaaatatgatgaatagcagccaaacattggttgtgaaactgggaacaagtgtattg
acgggtggatcgcgtcgcctcaatcgagcccatattgtggagcttgttcgtcaatgtgct
cagcaacatgaaaaaggccaccgcattattattgtgacttccggtgcgattgcggcaggt
cgggaacatctgggatacccggatttgcctgccactattgcttctaaacaattattggct
gcggtaggtcaaagccggttgattcagttatgggaacagcttttttctatttatggtatt
catgttggacagatgttattgactcgtgcagatttggaagatcgtgagcgttttttaaat
gccagagacactctgcatgctttgctcgacaatcgtattgttcctgtaattaatgagaat
gatgcggttgctactgctgaaattaaagttggtgataatgataacttatctgccctggca
gcaattttgggtggagcagataagctgttattgctgactgatattgaagggttatatacc
gctgatccacgtagtaatccaaatgcagaacttatcccggaagtttatgatatcagtgac
gaattacgtatggctgctggtgatagcgtttctggtttagggacggggggaatggcaact
aaacttcaggctgcgggaattgccggtcgtgccggtattgatgtgattgttgcagcgggc
agtaaatctaatgtcatctctgatgtcattgaaggtaacccggtaggtactcgcttccat
gggttggcaagcccaatggaaaaccgtaagcgttggatttttggcgcacctcccgcaggt
gaaattattgttgaccacggtgccggaacggcaatctgcgaaaaaggcagctctttatta
ccgaaagggattaaaaatattaaaggcaatttctcccgaggagaggttatctgcattcgt
agtctatctggcagggatttggcacgtggtgttagccgctataatagtgatgctttgcgt
ttgatagccggtcatcattcacagcagataagccaaatcctcggttatgaatatggcgct
gttgcggttcatcgtgacgacatgatcgtgagttaa

DBGET integrated database retrieval system