KEGG   Photorhabdus asymbiotica: PAU_03738Help
Entry
PAU_03738         CDS       T00941                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00561  Glycerolipid metabolism
pay00640  Propanoate metabolism
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PAU_03738 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PAU_03738 (gldA)
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PAU_03738 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC
Motif
Other DBs
NCBI-ProteinID: CAQ85826
UniProt: C7BLX0
Position
4340742..4341842
Genome map
AA seq 366 aa AA seqDB search
MLKVIQAPSKYIQGPDALLSIGKYTKTIADHVFVIIGNSAMKLVGDTVYNSLEEYDVTSH
FEVFGGECSRNEIQRLSDILKENECQAVIGIGGGKVQDTAKVVAYESKLPILIAPTISST
NAPSSALSVVYTDDGEFEDYLFFPTNPDIVLVDTALIAKAPTRFLVAGIGDALATYFEAR
ICSTAHKPRMTDGGISRTAMALAHLCYETLLEDGYKAKLAVDAGVSTPAVENVIEASIYL
SGLGFENTGLAAAHSVHNGFTVLEECHHMYHGEKVAFGVIVQLVLENSPNEELDTVLDFC
VQVGLPVTLDQLGVKDGEKLKEKVMAVAKASCAEGETIHNMPFEVTPEKVYAAILAADRM
GRDWLY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagttatccaagctccatccaaatatattcaagggcctgacgccttactctct
attggtaaatacacgaaaaccattgccgaccacgtctttgttattatcggcaactcagca
atgaaattggtgggagatactgtttataacagcctggaagaatatgatgttactagccat
tttgaagtgtttggtggggaatgtagccgaaatgagattcaacgtctgtctgatattcta
aaagaaaatgaatgccaggcggttattggtatcggtggcggtaaggtacaagatacagca
aaagtggttgcctacgaatccaaattacccattctaattgcccccacaatatcctcgact
aatgccccatccagtgccttatctgttgtttataccgatgatggcgaatttgaagattat
ctgtttttcccaacaaacccagatattgtactggtagatactgctctgatcgccaaagca
ccaacccgttttctggttgccggaattggagacgcactggctacctattttgaagcccgc
atctgtagcactgcccataaaccaagaatgacagatggcgggatatcccgcacagcaatg
gctcttgcccatctatgttacgaaaccttattagaagatggttataaagcaaaattagcc
gttgatgctggagtcagtacgccggcggtagaaaatgttatcgaagccagcatttacctg
agtggcttgggatttgaaaatacaggtctagccgccgcacattccgtacacaatggcttt
accgtattggaagagtgccaccacatgtaccacggagaaaaagttgctttcggagtaata
gtccaactcgtgctggaaaacagtccaaatgaagaattggatacggtactcgatttctgt
gtacaagtagggctacctgtcactctggatcagcttggcgtgaaagacggtgaaaaactg
aaagaaaaagtgatggcagtagcaaaagcaagttgtgctgaaggtgaaactattcacaac
atgccttttgaagtgacaccagaaaaagtgtacgccgctattctggcggctgaccggatg
ggacgcgactggctgtactaa

DBGET integrated database retrieval system