KEGG   Photorhabdus asymbiotica: PAU_03756Help
Entry
PAU_03756         CDS       T00941                                 

Gene name
groL
Definition
(GenBank) 60 kda chaperonin (protein cpn60) (groel protein)
  KO
K04077  chaperonin GroEL
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pay00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PAU_03756 (groL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pay03019]
    PAU_03756 (groL)
   03110 Chaperones and folding catalysts [BR:pay03110]
    PAU_03756 (groL)
   03029 Mitochondrial biogenesis [BR:pay03029]
    PAU_03756 (groL)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_03756 (groL)
Messenger RNA biogenesis [BR:pay03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     PAU_03756 (groL)
Chaperones and folding catalysts [BR:pay03110]
 Heat shock proteins
  HSP60 / Chaperonin
   PAU_03756 (groL)
Mitochondrial biogenesis [BR:pay03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    PAU_03756 (groL)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAU_03756 (groL)
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_03756 (groL)
  Exosomal proteins of breast cancer cells
   PAU_03756 (groL)
  Exosomal proteins of colorectal cancer cells
   PAU_03756 (groL)
  Exosomal proteins of bladder cancer cells
   PAU_03756 (groL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 REF
Motif
Other DBs
NCBI-ProteinID: CAQ85844
UniProt: C7BLY8
Position
complement(4358163..4359809)
Genome map
AA seq 548 aa AA seqDB search
MAAKDVKFGSDARVKMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREI
ELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQSIVTEGLKAVAAGMNPMDLKRGI
DKAVVAAVEELKKLSVPCSDSTSIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEEG
TGLEDELDVVEGMQFDRGYLSPYFINKPETGSVELENPFILLVDKKISNIRELLPVLEGV
AKASKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIAVLTNGIV
ISEEIGLELEKATLEDLGQAKRIVINKDTTTIIDGVGEETAISGRVSQIRQQIEESTSDY
DREKLQERVAKLAGGVAVIKVGAATEVEMKEKRARVDDALHATRAAVEEGVVAGGGVALV
RVAAAIAGLKGDNEDQNVGIRVAMRAMEAPLRQIVDNSGEEPSVVANNVKAGEGNFGYNA
TTEQYGDMIAMGILDPTKVTRSALQFAASIAGLMITTECMVTDLPKDDKADLGAAGGMGG
MGGMGGMM
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaaagacgtaaaatttggtagcgatgctcgcgttaagatgctacgtggtgtg
aatattcttgctgatgcagtaaaagtaaccttgggacctaaaggccgtaacgttgttctg
gataaatcttttggtgctcctacaatcactaaagatggcgtttcagttgctcgtgaaatt
gaactggaagataagttcgaaaatatgggcgctcagatggtgaaagaagttgcctctaaa
gcgaatgatgctgcgggtgacggtacaacgacagcaactgtattggctcaatctattgtt
actgaaggtctgaaagccgtagccgctggcatgaacccaatggatctgaaacgtggtatt
gataaagctgtggttgcagcagttgaagaattgaaaaaactgtccgtaccttgctcagat
tccacctctattgctcaggtaggcactatttctgctaattccgacgaaaccgtgggtaag
ttgattgcagaagcgatggacaaagtcggtaaagaaggtgtaatcaccgttgaagaaggt
actggcttggaagatgaactggatgtcgttgaaggtatgcagttcgaccgtggctacctt
tctccttatttcatcaacaaaccagagaccggttctgttgagttagaaaatccatttatt
ctgttggtagataaaaagatctccaacatccgcgaactgctgccagttctggaaggtgtt
gctaaagcaagcaagcctctgctgattattgctgaagatgttgaaggtgaagcgctggca
actctggttgttaataccatgcgtggcatcgtaaaagttgctgcggttaaagctcctggc
ttcggtgaccgccgtaaagctatgttgcaggatatcgctgttctgactaacggtattgtt
atctctgaagagatcggtctggaactggaaaaagcaactctggaagatctgggtcaggca
aaacgcatcgttatcaacaaagatactacaactatcattgatggcgttggtgaagaaact
gcaatttctggccgtgtttctcagatccgccagcagatcgaagaatccacttctgattat
gatcgtgaaaaactgcaagagcgcgtagctaaactggctggcggtgttgctgttatcaaa
gttggtgctgcgacagaagttgaaatgaaagaaaaacgcgctcgtgttgatgatgccctg
catgcaactcgcgcagcagtagaagaaggcgtagtagctggtggtggtgttgcactggtt
cgtgttgcagctgctattgctggtctgaaaggtgacaacgaagatcaaaacgtaggtatc
cgtgttgcaatgcgcgcaatggaagcacctttacgtcagatcgttgacaactcaggcgaa
gaaccttcagttgttgcaaacaatgtgaaagcaggtgaaggtaacttcggttataacgcg
acgactgaacagtatggcgatatgatcgcaatgggtattctggacccaactaaagtgacc
cgttctgcgctgcaatttgcagcctctattgctgggctgatgatcaccactgaatgtatg
gtgactgacctgcctaaagatgacaaagctgatttaggtgcagcaggcggtatgggtggc
atgggcggaatgggcggcatgatgtaa

DBGET integrated database retrieval system