KEGG   Photorhabdus asymbiotica: PAU_03772Help
Entry
PAU_03772         CDS       T00941                                 

Gene name
yqeF
Definition
(GenBank) probable acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00071  Fatty acid degradation
pay00280  Valine, leucine and isoleucine degradation
pay00310  Lysine degradation
pay00362  Benzoate degradation
pay00380  Tryptophan metabolism
pay00620  Pyruvate metabolism
pay00630  Glyoxylate and dicarboxylate metabolism
pay00640  Propanoate metabolism
pay00650  Butanoate metabolism
pay00900  Terpenoid backbone biosynthesis
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
pay01212  Fatty acid metabolism
pay02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAU_03772 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    PAU_03772 (yqeF)
   00640 Propanoate metabolism
    PAU_03772 (yqeF)
   00650 Butanoate metabolism
    PAU_03772 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PAU_03772 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    PAU_03772 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAU_03772 (yqeF)
   00310 Lysine degradation
    PAU_03772 (yqeF)
   00380 Tryptophan metabolism
    PAU_03772 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAU_03772 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAU_03772 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAU_03772 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_03772 (yqeF)
Enzymes [BR:pay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PAU_03772 (yqeF)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_03772 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: CAQ85860
UniProt: B6VL86
Position
4373048..4374226
Genome map
AA seq 392 aa AA seqDB search
MRDVVVVAAKRTATGSFQGSLAAQPATFLGSTVIQALLAESGVAALDIEQVIMGQVLTAG
CGQNPARQAALRAGLPVTIQAMTINKVCGSGLKAVHLGMQAIQSGEAEIVIAGGQENMSL
APHILPMSRQGIRLGHSELKDSLVHDGLWDAFHHFHMGVTAENVAKQFNITRAQQDEYAL
LSHHRAVHAQQAGYFNDEIVAVEIAGRKGEILRFVQDEGPRETSIEKLSSLKPVFQKEGT
VTAGNASSLNDGAAAVLLCSREKAESLNLQPLATLSGFANTGIEPELMGAAPIEAIHQCI
LKQQWKPEDVDVLESNEAFAAQALAVLSSCGIPSERVNPYGGAIALGHAIGASGCRILVT
LIHNLKRNRLQNGIAALCIGGGEGVALAVTRS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgttgttgttgttgctgctaaacgtacggcaacaggcagtttccagggttcg
ctagctgctcaacctgcaacttttcttggcagtacggtcatccaagccttgctagcagaa
agcggtgttgctgcactagatattgaacaggtcattatgggacaagtgctgacggccggt
tgtggacaaaatccagcgcggcaagctgcattgcgagcggggttaccagttactatccaa
gctatgaccattaataaggtctgtggttcaggtctgaaagctgttcatttgggtatgcaa
gcgatccaaagtggtgaagcggagatagttattgctggtgggcaggaaaacatgtctctg
gctcctcacattctacccatgtctcgacaagggattcgtctcggccacagtgaactgaaa
gatagtttggtacatgatggcctttgggatgcttttcatcattttcacatgggagtaaca
gcagaaaatgtcgcaaagcaatttaatataacacgtgctcaacaggatgaatacgcgctt
ctatcacatcaccgggctgttcatgctcaacaggcgggatatttcaatgacgagattgtt
gctgttgagatagccggaagaaagggagaaattctccgtttcgtacaagatgaggggcca
cgggagactagcatagaaaaattatcttctctgaagcctgtctttcagaaagaagggacc
gtgacagccggtaatgcatcttccctgaatgatggcgctgcagcagtgttattatgtagc
cgcgagaaagcagaaagtctaaatttacagccattggctactttgagcggctttgccaat
acaggtattgagcccgagcttatgggagcggctcccattgaagcgatacaccagtgtata
ttaaaacagcagtggaagcctgaggatgttgatgtacttgaatcaaacgaggcatttgct
gcacaggctttggctgtgctttcttcgtgtggtattccatctgagcgtgtcaatccttat
ggtggtgctattgctttaggacatgccatcggtgcttctggatgtcgcattcttgtgacg
ttaatccataacttgaaacggaaccgtttgcagaatggtatcgctgcgctgtgtattggc
ggtggtgaaggagtggctttggcggtcactcgttcataa

DBGET integrated database retrieval system