KEGG   Photorhabdus asymbiotica: PAU_03785
Entry
PAU_03785         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAQ85873
UniProt: B6VL99
Position
4391166..4391696
AA seq 176 aa
MLLLPRHKSHCFFAFILLSILLSVSCSANKAEENIPYTIKFQTHGDINNHAPLKLNILLL
SDPDKFNQADIGSLQKDTHSTLNDTVLCQKSIFLLPKKEQQNDISITINTPSTEKYIAIW
AEYQNISDKQWRIAIPLSSFLTTPSLSVLNPFSSSELYQLITVTSHGLQIASASDQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgttgcttttacctcgtcataaaagtcattgtttctttgcctttattctgctgagcata
cttctaagtgttagttgttctgcaaataaagcggaagaaaatattccatacacaattaaa
ttccagacacatggagatattaacaaccacgctccattaaaattaaatatattattgtta
agtgatccagataaatttaatcaggctgatatcgggtctttacaaaaagatacccattca
acgctgaatgatactgtactttgtcaaaaatccatcttcttactgccgaaaaaagaacaa
caaaatgatatcagtattaccattaatacaccgtcaacggagaaatatattgcgatttgg
gccgagtatcagaatattagtgacaaacaatggcggatcgctattcctctatcatcgttt
ctaaccacaccttctttatcggttttgaatcctttttcatcttctgagctttatcagttg
attaccgttacttctcacggattacagatagcatctgcgtccgatcaatga

DBGET integrated database retrieval system