KEGG   Photorhabdus asymbiotica: PAU_03786
Entry
PAU_03786         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03786
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03786
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: CAQ85874
UniProt: B6VLA0
Position
4391722..4393071
AA seq 449 aa
MKNAHKVLWMEGMFLRPHHFQQADEYVDARLRQWGALQRAYNWGFSSLKIDESQLTLGKI
SLLAASGIMPDGTSFEFTETNEAPPALAISTSLRSQIITLAIPAYLAGRESVSFDDAPDS
LARYQAFEKEVNDINSLALSSTTLHCGRLRLRLLPENELNSEWIAMGVLRVLEKNQDGIV
ILDTGYIPPLLNCWTSPLLQNITHDLYGLLLQRSRQLSRHLQCNGSCTSDLLRLALLNRF
SAQLQHIMHLPQQAPEMLFLSWISYALEMSSFQAPYTLEGELPRYNHLDIGGCFTRLCTL
LQRSLSIVLEEHVVSLPLTKRLPGLSVATLPEQMNLDDYHFVLVVKSEMEHDSFMTHFPA
QIKIAPADRIRDLVRLQLPGIALRHLVQIPRQLPYQNGHCYFKLELNSKTEQSLGKSGVF
AFYIAGEFPGLKMAFWALKRLSDEEEMNL
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaaaaatgcacacaaagttctctggatggaaggcatgtttttacgacctcaccatttt
caacaagcagatgagtatgtagatgcacgcttacgtcaatggggagctttgcaacgagcc
tacaattgggggttttcatcattaaaaattgatgagagccagcttactctgggaaaaatc
tcactgctggcggccagcggtattatgcctgatggcaccagttttgaatttactgaaacc
aatgaggccccaccagcattagcaatcagcacttcactacgttcacaaattatcacctta
gctataccggcatatctggccggacgtgaatccgtcagtttcgatgatgcacccgattct
ttggcgcgttatcaagcatttgaaaaagaggtcaatgacatcaattcgctggcactcagt
agtacgaccttacattgcgggagattacgcctgcgtctgctaccagaaaatgagttgaat
agtgaatggattgccatgggagtactgcgggttttagaaaaaaatcaggatggtattgtc
attcttgatacaggatatattccaccgttgcttaactgttggacaagcccgttattacag
aacataactcatgatctgtacggtctattattacaacgcagtcgacagcttagccgtcat
ctgcaatgtaatggttcttgcaccagtgatttattacgactggcgctattaaaccgtttt
agcgctcagctgcaacacatcatgcatctgcctcaacaggcacccgaaatgcttttcctt
agctggatcagctatgcactggaaatgagttcttttcaagcgccttatacattggaggga
gaattaccccgctacaaccatctggatatcggtggttgcttcacccgcctctgtacttta
ctgcaacgcagtttgtcgattgtgctggaagagcatgttgtatcactgcccctgaccaaa
cgcctaccaggactgagcgtcgcaacactgccagaacagatgaatctggatgattaccac
ttcgtcttagtcgtgaagtctgaaatggagcatgactcttttatgactcactttccggcc
caaatcaaaatcgcgccagctgatcgcatacgcgatctggtgcgcctgcaattgccaggt
attgccctgcgccacttggtacagatccccagacaacttccctatcagaatgggcactgc
tatttcaaattggaattaaacagtaaaactgaacagtcgctgggaaaatccggggtgttt
gccttctatattgcgggtgagtttcctggtctgaaaatggcattttgggcgcttaaacgt
ctgtctgatgaggaggaaatgaacctatga

DBGET integrated database retrieval system