KEGG   Photorhabdus asymbiotica: PAU_03787
Entry
PAU_03787         CDS       T00941                                 

Definition
(GenBank) outer membrane protein, ompa/motb family
  KO
K11892  type VI secretion system protein ImpK
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03787
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03787
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAQ85875
UniProt: B6VLA1
Position
4393068..4394231
AA seq 387 aa
MNHNYRNPLVQAAYPLLNAMPHIRHTAKLEDSSQLRQQLIGEMYRFEKQCQQQGFSYETI
LGARYCLCTCLDEAVALTSWGSDSIWSGNGLLVTFHKESSGGEKFFKLLDMLLEQPAKHI
DLLELFYFCLLLGFGGRYRLIDNGLAQLETLTQRLAIRLRQVRGEYSVALSTLPPLPVNT
HQTSRLTHFLVFCSLSGVLLTGSLYIGLNTRLDQQTEPVLTSIYDLPLPEAALPTESFSI
AHLRQVLQPMIEQQDITVSQNADNVSVTLQGGGLFASASATLNPLYQTPLQELAKQLNLT
TGKVIVRGHSDNLPIHTHTYSSNYALSLARAETVAQQLRTNLLQPQRLQVESAGAEAPLV
PNTTAKNRALNRRIEIIFNTQSDNSGQ
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgaatcataactaccgtaacccattggtacaggcagcttatccactattaaatgcgatg
ccacatattcgccacaccgcaaaactagaagattccagtcagttacgccaacaactgatt
ggagaaatgtatcgctttgagaaacagtgccagcaacagggattcagctacgaaacgatt
ctcggcgcccgttattgtctgtgcacttgtttagatgaagcagtcgcattgacctcttgg
ggaagcgatagcatatggtcaggtaatggcctgttggtgacattccataaagagagcagt
ggtggtgaaaagtttttcaagctactggatatgttgctggaacaaccagccaaacatatc
gatttactcgaactgttctacttttgtctgttactgggatttggtggacgttatcgcttg
attgataacggcctggctcaattagaaaccctcacccagcgcctggcaatacgtctgcgt
caagtgcgaggggaatattccgtggcattaagcactcttccgcctctccctgtcaacaca
catcagacatcacggttaacccattttttggtgttttgctcgctgtctggagtactgctg
actggttcactctacatcggattaaacacccggcttgatcaacaaacagaacccgtgttg
acatccatatacgacctgccactaccagaagcggcattaccgactgaaagtttctctatt
gctcatttgcggcaggttctgcaaccgatgattgaacaacaggatatcaccgtcagccag
aacgcagataatgtcagcgtaaccctacagggaggcggcttatttgcttctgcatcagcg
acacttaatccactctatcagacacctctccaggagctggctaaacaactgaacctgacg
actggtaaggttatcgttcgtgggcatagtgataatctgccgattcatacacatacctac
tcctctaactatgcgctgtcattggcgcgagcagaaacggtagcacaacagttacgcact
aacttgctccaaccacaacggctacaggttgaaagtgctggcgcagaagctcctttagtc
cccaacaccaccgccaaaaatcgggctttgaaccgccggattgaaattattttcaacacc
cagtcggataattcaggccaatag

DBGET integrated database retrieval system