KEGG   Photorhabdus asymbiotica: PAU_03788Help
Entry
PAU_03788         CDS       T00941                                 

Definition
(GenBank) Putative membrane Protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03788
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03788
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: CAQ85876
UniProt: B6VLA2
Position
4394248..4397805
Genome map
AA seq 1185 aa AA seqDB search
MLRAFIAIITNRLFWGALIVAALCLLIWIIGPFIAIGDHHPLATEVQRQIAITALISLWL
LLRLLPFLYQVWVNARLRRRLHHVSNVTPTTRNASQSLADNFKQAASLIKRGLRLNGEQL
TTRLGKFYLYRLPWYLVLGTKGCGKDKSLLNSGLDFYHTTYPSQFAFPETNAESHCSWYF
TLQGVILSPAGEYLKEGNPLWQALLKLLKRYRPRQPINAVILTISVQDLLQQDNDAQYHQ
ALLLRKRLMDLRLQLKIDFPVYVMITKADLLPGFSSYFNGFYGEELDQVWGFTFPWEQAL
HSHNDLQQMLDEQYDRLQQRLDAALADTLITQQDITQREQSFAFPQAFATLRPVLMRYLS
IIFATSGFDRPWLPHGLYFTSANQKHGEFQHSNGTTQDNLFDYSYALSSVTNSDGETTHR
TARSYFLRQLFQKIILAESGLAGINRMYELRRRFMLLTGCGLLLSLMAGICLLLLTSYHN
NKSYLAQITARLPLLEQQGRALNKPSARDLPHLIQYLTQLQSLTTNQQINPDSPPLVYGM
GLYQGPQLNSASYPVYQHALKNLLLPLVTQQVESILRQQADSNNSESTYEALKAYQMLFQ
TQHYDGKFLTAWLMLNLSHIPSGEKLNEAQRQALQEHLYQLLNHSQPSWSQHKDQQLIQE
AIKNIMRSTFSQRVYTSIKKRLINSGRFKSVNLLDLAGSQAELVLKRKSDLPDTAAIPGF
FTPDGYWHGLVAQVDDTVKTLHDTDRWVLNIPPQVQEGCDAACRVRQLYMDDFMLEWDTF
LNDIALIPTSSLNQRINNVRILSGAHSPLRNLLIGISHIVALSPPEDHGKLTQLGQQLND
EASRKLQNLFPAVRTTPAPPSPEQIVRSHYRDLLDLARPQGNNSDAIAFDDLFKKLGDLY
RYLTALQENGEATASSSGTILTQLQADAGRLPAPFRSIIMDMTQGAKGDTQQQAVSRIHQ
LANAQLSDFCREAIAGRYPLSRHSKRDMTPDDMAHMFAPNQGLMDRFFNQYLVDKVNTQG
NEWRFFPWALGSTKPEDQSLLKTFRQAQFVRDAFFGTASSQPSFSLTLQPLRMDNDILTL
SLTLNDQNASYSHGPLTSWYFTWPGSNNAGKAKLTMLLANGKTKSLETSGPWALNRLIDA
GKWFQEDSMHYRITFNLAGHQATLILTPDSIHNPFVLPEFTCIKP
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgttaagagcatttatcgccatcatcactaatcgcctgttttggggggcgctgatcgtt
gccgcattgtgtctgcttatttggatcatcgggccatttatcgccatcggtgatcaccat
ccactagcaaccgaagtccaacgccaaatagctatcaccgccctgatttcgctgtggtta
ttgctacggctgttgccttttctctatcaggtatgggtaaatgctcgtttgcgccgccgt
ttacaccatgtcagcaatgtcacgccaacaacccgaaacgcctctcaatccctcgctgac
aattttaaacaagcggcgtccctgatcaaacgagggttacgtctgaatggcgaacaactc
accacacgtctgggcaaattctatctctatcgcctgccctggtatctggttttgggtacc
aaaggatgtggtaaagataaatctctactgaattcagggttagacttctaccacacaacc
tatccaagccagttcgcttttcctgaaaccaatgccgaatcgcactgttcatggtatttc
accctgcaaggcgtcattcttagccctgccggagagtaccttaaggaaggcaaccctttg
tggcaggccttattaaaactgctaaaacgttatcgtccacgtcagccaatcaacgccgtt
attctgacaatcagcgtacaagatctgctgcaacaagataatgacgcgcaatatcatcag
gcgttattactgcgtaagagactgatggatttacgtttacaactgaaaattgactttccg
gtctacgtgatgatcaccaaagctgacttgctcccggggttcagtagctacttcaacggt
ttttatggcgaagaattggatcaggtctggggtttcacctttccctgggaacaagcattg
cattcccataacgatttacaacagatgctggatgagcaatatgaccgtttgcagcaacgt
ctggacgctgcactggcggataccttaataacccaacaggatatcactcaacgggaacaa
agctttgccttcccacaggcatttgccaccctacgcccagtcttgatgcgttatctgagt
attatttttgccacttctggctttgatcgcccatggttaccacatggtctctatttcacc
agcgctaaccaaaagcatggggaatttcagcacagtaatggaactacgcaagataatctg
ttcgattacagttatgcgctttcctctgttaccaatagcgatggcgaaacaactcaccgg
actgcccgcagttactttctgagacaattattccaaaaaatcattttggctgagagtggg
ctggcagggatcaaccgcatgtacgaattgcgccgacgcttcatgctactgaccggatgt
ggactattactcagtctaatggctgggatctgcttactactactgacaagttaccacaat
aacaagagttatctggcacaaattacagcccgacttcctctactagaacaacagggccgg
gcgctgaacaaaccatcagctcgcgatctaccacacttgatccagtatttgacacagcta
cagtcactgacaactaatcagcaaattaatccagacagtccgccacttgtttacggtatg
ggattatatcaaggcccgcaactgaacagtgccagctatcccgtttatcagcatgcgtta
aagaatttattgctgcctctggtgacacagcaagtcgagagtattctgcgtcagcaagct
gatagcaataacagtgaatcaacttacgaagcactgaaagcctaccaaatgctatttcag
acacaacattacgatggcaaattccttaccgcttggctgatgttgaatctgtctcatatt
cccagtggtgaaaagttgaatgaggcacaacgtcaagcacttcaggaacatctttatcag
ctactgaatcacagtcaaccttcctggtctcaacacaaggaccaacagctgatacaggaa
gcgataaaaaatatcatgcgttctacgttttcccagcgggtttataccagcataaaaaaa
aggctgatcaatagcggacgtttcaaatccgtcaatctgcttgatttggcgggttctcag
gctgagttggtattaaaacgtaaaagcgacctgccagatactgcggcgatccccggcttt
tttacaccagacggatattggcacggtctggttgcacaggtcgatgatacggtaaagaca
cttcatgatactgatcgctgggtactcaatattccgccacaggtacaggaagggtgcgac
gctgcctgccgagtacgccagctttatatggatgactttatgttggagtgggatacattt
ctcaatgatatcgctctaatcccgacaagtagcctcaaccagcgtattaataatgtgcgt
attctctctggcgcccactcgcccctgcgtaatctgctaattggcatcagccacattgtt
gcattatctccacccgaagatcatggcaaactcacgcagctgggccagcaactgaacgat
gaagcctctcgaaaattacaaaatctgtttccggcggtcagaactaccccagcgccacct
tcaccagaacagattgttagaagtcactatcgtgatctgctcgatctggcacgtccacag
ggaaataacagtgacgcgatcgcctttgatgatctgttcaagaaactgggggacttgtat
cgctaccttaccgccttacaggaaaatggtgaagcgacagcctcctcttcgggtaccata
ctgacacaattacaggctgatgccggccgcctgcctgctccgttccgcagcattatcatg
gacatgacgcagggggccaaaggcgacacgcaacaacaggcagtttcgcgcatacaccaa
ttggccaatgctcagttaagtgacttctgccgtgaggccattgccggacgttatccgctt
tcccgccacagcaaacgtgatatgactcccgacgatatggcacatatgtttgcgccgaat
caggggttaatggatcgcttttttaatcaatatctggtggataaggtcaacacccaaggc
aacgaatggcgctttttcccctgggcactaggcagtaccaagccagaagatcagtcactg
ctaaaaacattccggcaagcgcagtttgtccgtgatgcattttttggtaccgcctcttca
caaccctctttctcccttaccttgcaacctctgcgcatggataacgacatccttaccctg
tcgctgacactcaacgatcaaaatgccagttacagccacggtccgctgacatcctggtac
ttcacctggcccggtagcaacaatgccggtaaagccaaactgaccatgctgttggctaat
ggcaaaaccaaatcactggaaacttcagggccttgggcattaaacaggctgattgatgca
ggaaaatggtttcaggaggacagcatgcattatcgaatcactttcaatctggcagggcac
caagccacgctgatactcacccccgatagcatacacaacccgtttgttctgccggaattt
acttgtatcaaaccataa

DBGET integrated database retrieval system