KEGG   Photorhabdus asymbiotica: PAU_03791
Entry
PAU_03791         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03791
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03791
SSDB
Motif
Pfam: VipB VipB_2 Sec7_N
Other DBs
NCBI-ProteinID: CAQ85879
UniProt: B6VLA5
Position
4399467..4400975
AA seq 502 aa
MSQSEIHAASENQTQTDSYSQGELSALLKKEFRPKTDQARLAVENAVKTLAHQALENSLT
LSSDTFSTIQALIAAIDNKLSQQINEILHHPDFQALEGAWRGLLYLVNNTETSEMLKIRV
MSVEKKELGRTLKRYKGTAWDQSPVFKRIYEEEYGQFGGEPLGCLVGDYYFDHNPQDVEL
LGEMARIAAAAHCPFISSASPGVMQMETWQELANPRDLSKIFLNTEYASWRSLRESEDAR
YIGLVMPRFLARLPYGISTNPVEGFDFEEKTAGATHSNYVWSNAAYAMAVNINRSFKEYG
WCASIRGVESGGAVDKLICHTFPTDDGGLDIKCPTEIAISDRREAELAKNGFIPLVYRKN
SDFAAFIGAQSLQKPAEYMDADATANANLAARLPYLFACCRFAHYLKCIVRDKVGSFQNR
NDIERWLNKWILNYVDGDPANSSQQTKARKPLAAAEVQVSEQEDNPGYYQAKFFLRPHYQ
LEGLTVSLRLVSKLPSLKQSGG
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgagccagtctgaaatccatgctgccagtgaaaaccaaactcagaccgacagttacagc
cagggagagctcagtgcactactcaaaaaagagtttcgcccgaaaacagatcaagcacgc
cttgcggtggaaaatgcggttaaaactctggcacatcaggctctggaaaatagcctgaca
ttatcgagcgacactttcagcaccattcaagcgctgattgccgctattgacaacaaactc
tctcaacagatcaacgaaattctccatcatcctgattttcaggctctggagggggcatgg
cgtgggctgctctatctggtgaacaacacagaaaccagcgaaatgctaaaaatacgtgtt
atgagcgtcgagaagaaagagttaggacgcacactgaaacgctataaaggaacagcctgg
gatcaaagtcctgttttcaaacggatttatgaagaagaatacggccaatttggcggagaa
cctcttggttgtctggtcggtgattactatttcgaccacaatccgcaggacgttgagttg
ctgggagaaatggcccgtatcgctgccgctgcccattgtccttttatcagcagcgcttcg
cccggagtgatgcaaatggaaacctggcaagagctagcaaacccgcgcgatctaagcaag
atctttctcaacaccgaatacgcatcttggcgtagtttgcgtgaatcagaagatgcccgt
tatatcggcttagtcatgccacgttttctggctcgtttaccttacggaatcagtaccaat
ccagttgaaggattcgatttcgaagaaaaaaccgctggggccactcatagtaactacgta
tggagcaacgcagcctatgccatggcggtcaatatcaatcgctcatttaaagaatatggc
tggtgtgcatccatccgaggcgtcgagtcaggcggagcggtagataaactgatatgtcac
actttcccgacagatgatggcggtttagatatcaaatgcccgaccgaaatcgcaatcagt
gatcgccgcgaggccgagttagccaaaaacggttttatcccgttggtttatcgtaaaaac
tctgattttgccgcgtttatcggcgctcaatcactgcaaaaaccggcggaatatatggat
gcggatgccacagcaaacgctaatctggccgcccgtttaccttatctatttgcctgctgc
cgcttcgcgcattatctgaaatgcatagtgcgtgacaaagtgggatcgtttcaaaaccgc
aatgacattgaacgctggttgaataaatggattctcaactatgttgacggcgatcccgct
aactcctcacaacagaccaaagcgcgtaaaccgctggcagcggcggaagtacaagttagc
gaacaggaagataaccccggctactatcaagccaaattcttcctgcgtccccattatcaa
ctggagggattaactgtttccctacggttggtatcaaaactgccttctctaaaacagagt
ggcggttaa

DBGET integrated database retrieval system