KEGG   Photorhabdus asymbiotica: PAU_03792
Entry
PAU_03792         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03792
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03792
SSDB
Motif
Pfam: T6SS_HCP DUF2573
Other DBs
NCBI-ProteinID: CAQ85880
UniProt: B6VLA6
Position
4401008..4401529
AA seq 173 aa
MNNSIYLDIKDVSGECKDSNHPNGIDVHTFKWELSQPVETGSGGGGGSGRAKIHSLVVYA
RMDKAMPTLMQKLALGTHLPEVKLTMRKAGSEQQEFTTITLESALLDSIELVDFNRDIPH
LTEGSTDIKPGTIGVKYSFSPNKAKVIYKEQDNEGKSGAEVEFKWNTQTNRPE
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaacaacagtatctatctggatatcaaagatgtctccggtgaatgtaaagacagcaat
catcccaatggtattgatgtccatacctttaaatgggagctgtcacaaccagtagaaacc
ggtagcggtggcggtggcggaagtgggcgcgccaaaattcactctctggtggtctacgcc
cgtatggataaggcaatgccaacgttaatgcagaaattagcgctaggaactcatcttcct
gaagtgaagttaaccatgcgcaaggctggaagtgagcaacaagagttcaccactattaca
cttgaaagtgcgttacttgacagcattgagctggttgattttaaccgtgacattccgcat
ctgacagaaggttcaactgacattaagcccggtacaattggcgtgaaatacagcttctct
ccgaataaagccaaagtaatttataaggaacaggataacgaaggaaaaagcggtgctgaa
gtggaatttaaatggaacacacaaacgaaccgccctgaatag

DBGET integrated database retrieval system