KEGG   Photorhabdus asymbiotica: PAU_03793
Entry
PAU_03793         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07169  FHA domain-containing protein
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    PAU_03793
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: CAQ85881
UniProt: B6VLA7
Position
4401671..4402666
AA seq 331 aa
MQITIINTPAGDMTANSSHIFYPPGGTIGTSEDNHFVLPDPSNCISALQASVHISTQGAC
TITNIGTAFMMINNIPLARGETTSLQENSKLQIGNYSLTVNKTETTKYRSAEQEIPETDI
SAALWDELNATLPTEKNPTEDEQLSLANFMLPKQGTEPVLSLDQLATRPTDPMQLFTAQR
HSASGHTLFQQNTRQSVTPLQLWEEQVKQLDPLCMFKKEPTTATANDMTAPQTYQMSDRH
EQAMKEALFYCLNSIMNRFDPSYDENSVPAAHFWHMNGTQHRKAKLWDNFTERYQQTTEE
IRQQSSTLFNAFFLSIYQQKLNTIFDNNNGE
NT seq 996 nt   +upstreamnt  +downstreamnt
atgcaaataaccatcatcaatactccagcaggtgacatgacagcaaatagcagtcatatt
ttttatcctcccggtggcactatcggtaccagcgaagataatcattttgtgttgccagat
ccgagtaattgtatttcggcattacaagccagtgtacatatttctacccaaggtgcctgc
actattactaatattggaactgctttcatgatgattaataatatcccattagcgcgtgga
gaaaccacatctctacaagaaaatagcaaactccagattggaaattattccctgacggtg
aataaaacggaaacaacaaaataccgttctgccgaacaggaaataccagaaactgatatt
tccgcagcactatgggatgaattaaatgcaacattgcccacagaaaaaaatcctacagag
gacgagcagctgtcattagcaaattttatgctaccgaaacaaggaacagagcctgtgcta
tcccttgaccaacttgctacccgccccactgatccaatgcaactctttacggcccaacgt
cacagtgctagcggtcatactctgtttcaacaaaatacccgccaatctgttacaccattg
caactatgggaagagcaggtaaaacagctcgatccgctatgcatgttcaaaaaagaaccg
acaaccgccactgccaacgacatgaccgccccacaaacatatcaaatgtcagacagacac
gaacaggcaatgaaagaagcacttttctattgccttaactccatcatgaatcgttttgac
ccatcctacgacgaaaacagtgtccccgcagcgcacttctggcacatgaatggcacacag
caccgtaaggcaaaattgtgggataatttcactgagcgttaccaacaaactaccgaagag
atacgtcagcaatcatcgacattattcaatgcctttttcctcagtatttatcaacaaaaa
ttaaacacgattttcgacaacaataatggcgaataa

DBGET integrated database retrieval system