KEGG   Photorhabdus asymbiotica: PAU_03798
Entry
PAU_03798         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11907  type VI secretion system protein VasG
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03798
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03798
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03798
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 AAA_16 Sigma54_activat ATPase_2 AAA_22 AAA_25 AAA_7 TniB NACHT AAA_18 IstB_IS21 AAA_29 Clp_N AAA_30 Zeta_toxin Hpr_kinase_C Rad17 Mt_ATP-synt_D CxC7
Other DBs
NCBI-ProteinID: CAQ85886
UniProt: B6VLB2
Position
complement(4406762..4409386)
AA seq 874 aa
MPDINRQSLFNKLNPPLFSALESASAFCKLRGNPYVELAHWLHQLMQQKAGDLQQIMGHF
ALDEQQVARDIVQALDMLPRGASAISDLSAHIDEAVERAWVCSSVTFAAGEIRGAHLLLA
LLTTFNLRQHLLAISAQFARINAGSLAQDFTHILSNSTENGPQRTQAENGNNQSTSESAL
QNYAQDMTALARDGRIDPVVGRDKEIRQLVDILLRRRQNNPLITGEAGVGKTALVEGLAL
RIASGDLPPSLCHVQLWSLDIGRLEAGAGMKGEFEARLQAVINEVQQSPVPIILFIDEIH
MLIGAGGAQGVGDAANLLKPALARGQLRTIGATTWAEYKKHIEKDPALTRRFQVLQVEQP
DEALALQMIRSLSGQLEQHHGVLLLDEALEAAVSLSHRYIPARQLPDKAIALLDTTCARV
AVSQHSQPAVLEDYRRQLDALQIEYEIVCREQQLGGDHDARLAQLDEQRGELRAEEELMV
QRWQAEIALAQQIISLRQQLIANDETAVDDAQRLAWQTQLQDCRQQLSLLQGEQPLITVA
VDAHSVAAVVADWTGIPLGRMVKNELNVVQNLEHSLGQRVIGQQYALNIISERVRTARAH
LADPSRPVGVFLLCGPSGVGKTETALALAESLYGGEQNLITINMSEFQEPHSVSTLKGAP
PGYVGYGEGGVLTEAVRRRPYSLVLLDEVEKAHSDVHELFFQVFDKGWMEDGEGRRIDFR
NTLIILTSNVGSQEVINACSRQDGLPNIETLTQQLRQPLLRAFPAALLGRLTVLPFLSLS
DEMLENIVQLQLARVAQRLRENHGIAAQFDHRVTRQIMSCCMEQESGARRIDSIITNTLL
PQISRKLLTATIENQHYSQLQVTWEETAFQCHFC
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgccagatatcaatcgccagtcactatttaataaacttaatccgcccttgtttagtgct
ttggaaagcgccagtgcattttgtaagctacggggcaatccttatgttgaactggcgcac
tggttgcatcagctaatgcagcagaaagcgggcgatctacaacagatcatgggccatttt
gccttggatgagcagcaggtggcacgggatattgtgcaagcgctggatatgttaccgcgt
ggagcgagcgcgatttctgatctttctgcacatattgacgaggcagtagaacgggcttgg
gtgtgtagttctgtgacctttgcggcaggtgaaattcgtggtgctcacctgttgctggcc
ctgttgacgacttttaatctgcgccagcatttgttagctatttccgctcagtttgcccgt
attaatgcgggaagtttggcgcaggattttactcatatcctgagcaacagtacggaaaat
ggtcctcagagaacgcaggcagagaatgggaataatcagtcaacatcagagagtgcgtta
caaaattatgcgcaggatatgactgcactcgcgagggatgggcgaattgatcctgttgtt
ggtcgggataaagagattcgccaattggttgatattctgctacgccgtcggcaaaacaat
cctttgattactggtgaggctggcgtgggtaaaacggcgctggtggaaggattggcattg
cgtattgcatcgggtgatttgccgccgtcattgtgtcatgttcagctttggtcattggat
attggccgtttggaagcgggcgctggcatgaaaggagaatttgaggcacgtttgcaagcg
gtgattaatgaagttcagcaaagcccggttcccattattctgtttattgatgagatacat
atgctaattggtgcgggcggtgcgcaaggagttggtgacgccgcgaatttgttaaaaccg
gctctggcgcgtggacagttgcggactattggtgccaccacctgggcggaatacaaaaag
catattgaaaaagatccggcgctgacccggcgtttccaggtattacaggtcgaacagcca
gacgaagcgctagctttacaaatgatacggagtttgtctgggcaactggaacagcatcat
ggtgtgttattactggacgaggcgctggaagcggcggtatcgctctctcatcgttatatt
ccggctcgccaattgcctgataaagccatagctttgcttgataccacctgtgcacgggtc
gcggttagccagcacagtcaaccggcggtattggaggattatcgccgtcagcttgatgca
ctccaaattgaatatgagattgtttgccgcgagcagcaactggggggggatcatgatgca
cgcttggctcagcttgatgagcagcgcggtgaattgcgggcggaggaagaactgatggtt
caacgttggcaggctgaaatagcactagctcagcagattatcagcttgcgccaacaactg
attgctaatgatgaaactgcggtagatgatgcacagcgtctggcctggcagacacagtta
caggattgtcggcaacaattgagtttgttgcagggagaacagccattaatcacggtggcg
gtggatgcgcacagtgttgcggcggtggttgcggattggaccggcatcccgcttggtcgg
atggtaaaaaatgagctcaatgttgttcagaatctggaacacagcttagggcaacgggtt
attggtcagcaatacgcgctaaatatcatcagtgagcgggtgcggacagcgcgtgcacat
ttggctgatcctagtagaccggtgggagtatttctgctgtgtggtccttctggagtcggg
aagaccgaaacggcattagcacttgctgagagcctatatggtggtgaacagaatctgatt
accatcaatatgagtgagtttcaggagccacacagcgtatcaactctgaaaggggcgcca
ccgggatatgttggttatggtgaaggtggagtcttaacagaagcggttcggcgacgccca
tacagtttggtgttgcttgatgaggtggaaaaagcccattctgatgtgcatgaactgttt
tttcaggtattcgataaaggctggatggaagatggtgaaggtcggcgcattgatttccgt
aatacactgatcatattgacctcgaatgtgggtagtcaggaagttatcaacgcttgtagc
cggcaggatggtttgccgaatatagaaacgttgacacagcagttacgccaaccgttgtta
cgggcttttcctgccgcactgcttggccgtttgacggttcttccttttttatcattgagt
gacgaaatgttggaaaatattgtgcaattgcagctggcgcgggtggcacaacgtttgcgg
gaaaatcatggtattgcagcgcagtttgaccaccgagtgacgcgacagattatgtcctgt
tgtatggaacaggaatctggtgctcgcaggattgattcgattattacgaatactttatta
ccgcaaattagtcgtaagttgctgaccgcaacaatagagaatcagcattattcacaattg
caggtaacttgggaggagacggcgtttcagtgtcatttttgctga

DBGET integrated database retrieval system