KEGG   Photorhabdus asymbiotica: PAU_03815
Entry
PAU_03815         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11905  type VI secretion system protein
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03815
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03815
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CAQ85903
UniProt: B6VLC9
Position
complement(4431575..4432009)
AA seq 144 aa
MKQLRPSLYEMLTLNFNGDLDVDQIGKREQVILSVLNNMQRILNCRAGSLTHLPDYGLPD
LNTILQDLPASSQRLIATIEHTLLTYEPRLQQVNVTLLPQLEPAHLRYDINAELKGVGLV
RFSTEFVPEGKVLIRHLRQQGRID
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaaacagctgaggccctcactttacgaaatgttgacgcttaactttaatggagatctg
gatgtcgatcagatcggtaagcgggaacaggtgattttatccgtactgaacaatatgcaa
cgtatccttaactgtcgtgcaggttcgctcacccatttgccggattatggtttgcctgat
ctcaacacgatcttgcaagatttgcctgcatcatcacagcgtttgattgcgacgattgaa
catacgttgttgacttatgaaccacgtttgcaacaggtcaatgtgacattattgccacaa
cttgagccggcacatctgcgttatgacatcaatgctgaattaaaaggtgtgggattggtg
cgtttcagcaccgaatttgtgccggaagggaaggtattgatccgccatttacgccagcaa
gggcgcatagattaa

DBGET integrated database retrieval system