KEGG   Photorhabdus asymbiotica: PAU_03816
Entry
PAU_03816         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11906  type VI secretion system protein VasD
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03816
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03816
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03816
SSDB
Motif
Pfam: T6SS-SciN TraB DUF1338
Other DBs
NCBI-ProteinID: CAQ85904
UniProt: B6VLD0
Position
complement(4432013..>4432486)
AA seq 157 aa
LVGCGLTQTISDGTVAVTQSIFHKQVKTLHLDFSARSALNTNDAQTPLSTVIRVYQLKDN
KAFERASYAELLKGDSEALKADRLAQRDIRVAPKGSVMLDMPMEKAAKFVAVVGLFHTPD
ATNNDWRLVIRRDELDADKPRTIELGNGKLTLNPMKE
NT seq 474 nt   +upstreamnt  +downstreamnt
ttagtcggatgcggtctgacgcagactataagcgacggcacagtagccgttactcaatcc
atttttcataagcaggtgaagacactgcatctggatttcagtgcccgtagtgcgcttaac
accaatgacgcgcaaacaccgctgagtacggtgatacgtgtttatcaactcaaagacaac
aaagcctttgagcgtgccagttatgcggaactgttgaaaggtgacagcgaggcgcttaag
gcggatcggctggcacaacgggatattagggtggctccgaaggggagtgtcatgttggat
atgccgatggaaaaggccgcgaagtttgtggcggtggtggggctgtttcatacacccgat
gccaccaataatgactggcggttggtgatcaggcgtgatgagttggatgcagataaaccg
cgtactatcgaattaggtaacggcaaattaacattaaatcccatgaaggaataa

DBGET integrated database retrieval system