KEGG   Photorhabdus asymbiotica: PAU_03817
Entry
PAU_03817         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11895  type VI secretion system protein ImpH
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03817
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03817
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: CAQ85905
UniProt: B6VLD1
Position
complement(4432530..4433561)
AA seq 343 aa
MQRLAPNIYGFNFFRFCQLLESIQDERPPLGSTISPSDDPIRFRPHPGMGFPASELRNAE
CDEEQLPAIRTLFLGLYGVDSPLPTAYLDDIAQRREGYEGVTDFLDIFNHRIMTQYYRIW
RKYSYPATYHPGGKDETSQCLLGLVGLGIPGSQQQIATPVSRFLALLGTMRLPTRTAEGV
IKLVELLAPLTLAKVIPHDRRRVRLTLPARLSCRHPVQLSQRLVLGKMGTDVNSQMRLHL
YTEDTDEAQGWLPQRELHADLLVLLRVYLGWRCSVRLHLTLPKGILPAAQLGKQRIRLGR
TGVLGLKPGAPAVSGMVTINLGLYQGLLPSYQYREAENGSYQF
NT seq 1032 nt   +upstreamnt  +downstreamnt
gtgcagcgactggcgccaaacatttacggttttaacttttttcgtttctgtcagttgctg
gaaagtatacaggacgagcgtccgcctttgggcagtacgatttcacccagtgatgatccg
atccgttttcgtccccatcctggtatgggctttcctgccagtgaactgagaaatgcggaa
tgtgatgaggaacagcttccggcaatacgtaccttgtttctgggtctgtatggcgtggat
tcaccgctgcctaccgcttatctggacgatattgcccagcggcgtgaaggctatgaagga
gtgaccgattttctggatatttttaatcaccggataatgacccagtattaccgtatctgg
cgtaaatactcctatccagccacttatcatccgggcggtaaagatgagacatcacagtgc
ttgcttgggttggttggtttgggcataccgggtagtcagcaacagattgctacgccggtt
tcccgctttctggcactgcttgggactatgcggttgcccactcgaactgctgaaggggtt
attaagctggtcgagctgctggcaccgctgacactggcaaaagtgattccgcatgatcgc
cggcgggtgcggctgaccctgccggctcgtctgagttgccgccatcccgttcaactctcc
cagcgtctggtgttgggtaagatgggaacggatgttaacagtcagatgaggcttcatctt
tataccgaagataccgatgaagctcagggttggctgccgcagcgggaattgcatgccgat
ctgttggtactgctgcgtgtttatctggggtggcgttgcagtgtgcgattacatctcact
ttacctaaagggatattgccagcggctcagttgggaaaacagcgtatccggctaggtcgt
acaggtgtattaggattaaaaccgggagcgccggctgtttcaggcatggtgacaattaat
ctgggactttatcaagggctattgccaagttatcaatatcgggaggccgaaaatggcagc
tatcaattttaa

DBGET integrated database retrieval system