KEGG   Photorhabdus asymbiotica: PAU_03819
Entry
PAU_03819         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
  KO
K11910  type VI secretion system protein VasJ
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03819
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03819
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N HEPPP_synt_1
Other DBs
NCBI-ProteinID: CAQ85907
UniProt: B6VLD3
Position
complement(4435406..4437007)
AA seq 533 aa
MLQQLITNCFAERDALAEARERAVRWENWLLPISADAPTGDDPVYNDDFQRMREELNKLS
GIDTTLICQLAEKLLTTECKDVRVATYYVWARLHQEGESGLADGLGLLAALVDRFGETLL
PCRASSRKAALEWLVGTKIQDSLSLYPEVNRTDFEHIVSALALLEQTFATWDENARPSLV
GLAGTLENRLAQSGGVDAVVPQTAAPMPLSGGQVNSSAQGESSVLWGQVQSGRDLLERAR
ELARYLREQPQGWLSSARLMRSVRWDTVHQLPPLDADGRTRLVPPRTEYRALLKRLYRQQ
NWHDLLEQADRMFSESVNHFWLDLQWYLCQALNRLGSSYESWIEMVKHDLRMLLERLPGL
ENLAYNDGTPFADEVTAGWIAQQVHDSQADWSFVHSPMQPQHDDDVLALEPEAQQLADSE
GIDAALRWLGQLPSINGARQRWLQRLLMARMAEQYGKNEMALHLLTELNTDGQFNLGEWE
PALMFEVKACLLKLLRMKAQRSEQDKARMAQRMETLLAGLVAIDPVRAAVLCG
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgttgcaacaattgatcacaaactgctttgccgagcgtgatgcgctggcagaagcacgg
gaaagggcggttcggtgggaaaactggctgttacccattagtgctgatgctcccacaggc
gatgatccggtctataacgacgattttcagcgtatgcgggaggagctgaacaagctcagt
ggcattgataccacacttatctgtcaattggcggagaaactgttaactaccgaatgtaaa
gatgttcgcgtggcgacctattatgtgtgggcgcgtttacatcaagagggtgaaagcggc
ttggccgatgggctggggttactggctgcactagtagatcgttttggtgaaaccttgtta
ccttgccgggcgagcagtcgaaaagctgcgctggagtggttggtaggcaccaagattcag
gacagtttgtcactctatccagaggtaaatcgtaccgactttgaacatatcgtatcggct
ctggcgttactggaacagacgtttgctacttgggacgaaaatgcccggccctcccttgtt
gggctggcaggcactctggaaaaccgattagctcagtccggtggagtggatgcggtggtt
ccccaaacggctgctccgatgcctttatctggggggcaggtcaattcatcagctcagggt
gagtcatcggtattatgggggcaggtgcaatccgggcgtgatctgttggaacgagcacgt
gaattagcgcgctatctgcgtgaacagcctcaaggctggctctcttctgcacggctgatg
cggagtgtccgctgggatactgtgcatcaattaccaccactggatgctgacgggcgtacc
cgtttggtaccgccacgtacagaatatcgggccttgttaaaacggctctatcggcaacaa
aactggcatgatttattggagcaagccgaccgaatgttctcggaaagtgttaaccacttt
tggctggatttgcagtggtatctctgtcaggcattaaaccgattgggtagctcctatgaa
agttggatagagatggtgaaacatgatctgaggatgctgcttgaacggctgccggggctg
gaaaatctggcatataacgacggaacgccttttgccgatgaagtcactgccggttggatc
gcccaacaggttcatgactctcaggcagactggtcatttgtacattcaccgatgcagccc
cagcatgatgatgatgttttagctctggaaccagaggcgcaacaactggcggacagcgaa
ggcatagatgctgcattacgctggctggggcagctgccgagtatcaacggagcgcgacag
cgctggttacagcgcttgctgatggctcggatggcggagcaatacggcaaaaatgaaatg
gccttgcatttgctgaccgagctaaacaccgatggacaatttaatcttggtgaatgggag
ccggcactgatgtttgaggtgaaagcatgtctgttgaagttgctgcggatgaaagcacag
cgcagtgaacaggataaagcgcggatggcgcagcgcatggagactttgttagctggacta
gtggcgattgatccggtcagagctgctgtgctatgtggctga

DBGET integrated database retrieval system