KEGG   Photorhabdus asymbiotica: PAU_03820
Entry
PAU_03820         CDS       T00941                                 

Definition
(GenBank) Putative membrane Protein
  KO
K11891  type VI secretion system protein ImpL
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03820
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03820
SSDB
Motif
Pfam: IcmF-related IcmF_C IcmF-related_N
Other DBs
NCBI-ProteinID: CAQ85908
UniProt: B6VLD4
Position
complement(4437011..4440307)
AA seq 1098 aa
MFKAFIARNLGVGLVTNLIALVLGGLLYFWGARLGLDTPAVKIIVWIVSMVGVVWLLNLF
RDYKQCVPVPDIAAKVSVASAESSEGPFYFHRLQDHVRHRYGRFWRRKVRILMVMGQREQ
VEAIAPGLTKQHWLEGESNLLLWGGSLQVAPDVAQLKALRKLRRRCPLDGVVWVMTEEQL
SQRAEIDTALRMLEKQGQQLGWQAPVYVWHVQCSLWDQRDRPTQTVGCFLPSESPPPLLT
ESLNTLPSQLAARGMAQALANIRHDFLLRLAQSLREGGVTRLVRQLTPLLNRPSVWMAGV
MFSLPLAAQPGMTEHGWLVDASWNGVLEDVRHVRGNAVGFPWEKSAQWGLIVLAALWGMG
SVTSFFANRHQITLSRERVSQVSHRQHSLSDRLLSQHALQLELDRLQHRAEAGAPWYSRF
GLNQNGVLLRTLWPVYQRNNAPLIRDAAARVLHQRLADWVNLPPGSPQRCQQMKAAYAQL
KAYLMMARPEKADAAFMSRVLMESWPHRAGVRDGLWQNTGASLLRFYAQHLPQHPVWKII
ADAGLVSEVRQILLNQQGQRNAEATLYQHLLQQVAHSYGDLSLAQMTGATDASRLFSTNK
VVPGMFTRQAWEGQVQQAIAAVVASRREAMDWVLSDGGQPMAEAVSPGVLQARLRARYFR
DFAGAWLNFLNSLRWNRVHNLSDTLDQLTLMADVRQSPLIALMNTLAYQGETGQPDEGLS
DSLVNTARTLFQKTPPLVIDQNRGPQSPMENTFGPLLSLMGKTPGQALMTADSTLSLQTF
LTRVTRVRLTLQQIANTDDPQERMQALAQTVFQGKRVDLTDTQSYGSLIAASLGSDWSGF
GQTVFVQPLTQAWQTVLQPSAASINAQWQASVVSDWQAAFNGRYPFVDEQNEASLPVLGQ
FIAADTGRIEQFLQRELGGVLHKEGHYWVADKVGSQGLLINPAFLTAINQLSAIADVLFM
NGRQGLRFELRAKPVRDVAETDLTIDGQRLRYFNQMESWQRLRWPGESDNPGVVLTWTSV
DTGARVFGDYPGEWGLLRWLEQAKVKALDGGRYRLTFNAPDGLPLSWDLRTEQGKGPLVL
LGLKGFRLPAQIFSEKEE
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgtttaaagcttttattgcccgtaatctgggcgtggggttggtcaccaacctgatcgca
ctggtattggggggattgttatatttttggggggcgcgattagggttggacacgccggcg
gtcaaaataatcgtctggattgtcagtatggtcggcgtggtctggctgttgaaccttttt
cgtgattacaaacagtgtgtgcctgtaccggacatcgcagcaaaagtgtcggtagcgtca
gctgaatcatcggaaggcccattttattttcacaggctgcaagatcatgtccgtcatcgt
tatggtcgcttttggcgccgtaaagtacggatattgatggtgatggggcaacgggaacaa
gtggaagcgattgcgccggggctgacgaagcaacactggctggaaggcgagagtaatctg
ttgctgtggggcggcagcttgcaggtggctcccgatgtggcgcagttaaaggcattacgt
aaactgcgtcgtcgctgcccgttggatggcgtggtgtgggtgatgaccgaagagcaactg
agccagcgggccgagatagataccgcattacggatgctggagaaacagggtcagcagctt
ggctggcaggcgccggtgtatgtgtggcatgtgcaatgcagcctctgggaccagcgtgac
cgcccgactcagacggttggctgtttcctgccatcggagagcccgccgccgttgctgacg
gaaagcctgaacaccctgccgtcgcaactggcggccagagggatggcgcaggcgttagcg
aacatccgccacgattttttgttacggctggcgcagtctctgcgggaggggggagtcacg
cgtctggttcgtcagctgacgccgctgttaaaccggccatcggtatggatggcgggggtg
atgttcagtttaccgctggccgctcagccggggatgacagaacatggctggctagtggac
gcaagctggaacggggtactggaggatgtgcgccatgtccggggtaacgcggtgggtttc
ccgtgggagaaaagtgcccagtggggattaattgtgctggcggcgctgtgggggatgggc
agcgtgacgtcattttttgcgaaccgtcaccagataaccttgagccgtgagcgggtcagt
caggtcagtcaccggcagcattcattatcagaccgtctgctcagccagcatgcactgcaa
ctagagcttgaccggttgcagcaccgggcggaagccggggcaccgtggtacagccggttt
gggctgaatcagaatggggttctgctccggacactgtggccggtttaccagcgcaacaat
gcgccgctgatacgtgatgcggcggcgcgggtgttgcatcagcggctggccgactgggtc
aatctgccccccgggagtccacagcgatgtcagcagatgaaagcggcttatgcgcagctg
aaagcctatctgatgatggcccgcccggagaaagcggatgcggcttttatgagccgggta
ctgatggagagctggccgcatcgggccggggtcagagatgggctgtggcagaacaccggg
gcgtccctgctgcggttttatgcgcagcatctgccgcagcatccggtctggaaaatcatc
gccgatgccgggctggtcagtgaagtgcgccagatattgctaaatcagcagggtcagcgc
aatgcggaagcgacgctgtatcagcacctgttgcaacaggtggcgcacagctacggggat
ttaagtctggcacagatgaccggggccacggatgccagccggctgtttagcacgaataaa
gtggtgccgggcatgtttacccgtcaggcgtgggaaggtcaggtacagcaggcgatagcg
gcggtggtggcttcccggcgtgaagcgatggactgggtgttgagcgatggcggtcagccg
atggcggaagcggtttcgccgggggtgttacaagcccggctgagggcacgttactttagg
gatttcgcgggggcctggctgaattttcttaacagtctgcgctggaatagggtacataac
ctgtccgataccctggaccagttaactttgatggcggatgtgcgtcagtcgccgttgata
gcgctgatgaacacgctggcgtatcagggagaaaccggccagccggacgagggattatcg
gattcgctggtgaacacggcccggacgctgttccagaaaacgccgccgttggtgattgac
cagaaccgcggtccgcaaagtccgatggagaacacgtttggtccgttactgagcctgatg
ggaaaaacgcccggccaagcgctgatgacggcagacagtaccctgagtctgcaaaccttc
ctgacgcgggtgacgcgggtgcggctgaccctgcaacaaatcgccaatacggatgacccg
caggagaggatgcaggcgctggcgcagacggtgtttcagggaaagcgagtggacctgacg
gacacgcagtcatatggcagcctgatagcggcgagtctggggtcggactggagcggattt
ggtcagacggtgtttgtgcagccattaacacaggcgtggcagacggtgctgcaaccgtca
gcggcgagtatcaatgcgcagtggcaggcgtcggtggtgtcagactggcaggcggcattt
aacgggcgttatccgtttgtcgatgagcaaaatgaggcgtcgctgccggtgctggggcag
tttattgcggcggatacgggtcggattgagcagtttctgcagcgggagttagggggcgtg
ctgcataaagagggccactattgggtggcggataaagtggggagtcaggggctgctgatt
aacccggcgttcctgacggcgataaaccagctgagtgccatagcggatgtgctgtttatg
aacgggcgtcaggggctgcggtttgaactgcgggccaagccggtacgggatgtggcggaa
acggacctgacgatagacgggcaaaggctgcgttactttaaccagatggagagctggcag
cgtctgcgctggccgggggagagcgataatccgggcgtggtgctgacgtggacgagtgtg
gacaccggggcgagggtgtttggcgattacccgggggagtgggggctgctgcgctggctg
gagcaggcgaaggtgaaggcgttagatggtggccgttaccggctgacgtttaatgcgccg
gacggattaccgctgagctgggatttacgcacggagcaggggaaagggccgctggtcttg
ctggggctgaaagggttccggttgccggcccagatattcagcgagaaagaggaataa

DBGET integrated database retrieval system