KEGG   Photorhabdus asymbiotica: PAU_03822
Entry
PAU_03822         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical Protein
Organism
pay  Photorhabdus asymbiotica
SSDB
Motif
Pfam: PAAR_motif CXCXC
Other DBs
NCBI-ProteinID: CAQ85910
UniProt: B6VLD6
Position
complement(4441481..4441753)
AA seq 90 aa
MMFAGVIRLGDKLSSGGEVISVSSSIDIEGKRVALLNDLVSCPLKGHGINRIVEANAHCI
SDGKPIAFDKARCQCGCYVISSTPKAGIGE
NT seq 273 nt   +upstreamnt  +downstreamnt
atgatgtttgcaggtgttattcgcctgggcgataagctcagcagcggcggggaagtgatt
tccgtttcttcctccattgatattgaaggtaaacgcgtcgcattattaaatgatttagtc
agctgtccgctaaaagggcatggtattaatcgtattgttgaggctaatgctcactgtatt
tccgatggcaaaccgatagcgtttgataaagcgcgttgtcaatgtggctgttatgtcatt
tccagtacgcctaaagccggaattggggagtga

DBGET integrated database retrieval system