KEGG   Photorhabdus asymbiotica: PAU_03832
Entry
PAU_03832         CDS       T00941                                 

Definition
(GenBank) similar to clpa/b-type chaperone
  KO
K11907  type VI secretion system protein VasG
Organism
pay  Photorhabdus asymbiotica
Pathway
pay03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pay00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAU_03832
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pay02044]
    PAU_03832
Secretion system [BR:pay02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAU_03832
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 ClpB_D2-small AAA_16 AAA_22 AAA_25 NACHT TniB ATPase_2 IstB_IS21 Sigma54_activat AAA_23 Clp_N AAA_24 AAA_7 Zeta_toxin SRP54 Hpr_kinase_C
Other DBs
NCBI-ProteinID: CAQ85920
UniProt: C7BMP1
Position
complement(4454078..4456756)
AA seq 892 aa
MDTVSTSLLCRLNPYCAQALSAAAALCQTRAHAEITVEHWLLKLLEDGEGDITVIARRYE
WDMHSLWQSLLTTIDRLPRSINQRPRLSDSLYRLLQVAEFVASQEAGNESIRSVHLLQVL
RGQPDWLRTHDGWPLMSLSVSQLQHLRPLLDQHSAERPEVQAAARLADSGGGSAVAEIHP
DKPAQNAQALSPALQGVLDKFTLDLTARAAEGRIDPVFGRDNEIRQMIDILSRRRKNNPI
LVGEPGVGKTALVEGLALRIAGGQVPDSLKTVSVRSLDLGLLQAGAGVKGEFEQRLKNVI
EAVQQSPTPILLFIDEAHTLIGSGNQAGGTDAANLLKPALARGALRTIAATTWSEYKQYF
ERDAALERRFQMIKVDEPDDETACLMLRGLKARYARYHGVHIQDNAVKAAVTLSRRYLTG
RQLPDKAVDLLDTASARVRMSLDTVPEALTQRQAQLTALEMEQQAIEADSAVLPTEEDNT
RLKEIAVRREEVARQTEQLTAQYQREKSLAQRLLDLRQHSPKTPELREGIAELAELQGNE
PLLSLNVDVRTVATVVADWTGIPLSSLLKDEQTGLLHLEQYLGDRVIGQDMALREIAQRL
RAAKTGLTPEQGPLGVFLLVGPSGVGKTETALALADCLFGGERSLITINLSEYQEPHTVS
QLKGSPPGYVGYGQGGILTEAVRQRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFMRDGEG
REIDFRHTVILMTSNLGSDQLMALLAQQPDAPTATQHELLRPILRDHFQPALLARFQTVI
YRPLSAEALRRIVDIKLGQVTRRLNTHYGLTCTVESGLCDTLVNACLLPDSGARNIDSLL
NQQILPVLSQALLERLAHHHKPVGVTLGFNEEEGIILAFTEQTAVSDSGENA
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggatacggtatcgacttcattattgtgtcgcttaaatccctattgcgcacaggcacta
agcgcagcagcagcactctgccagacacgagcgcatgctgaaattactgtggagcactgg
ttgctaaaactacttgaagacggtgagggcgatattactgtgattgcccggcgttacgag
tgggatatgcattcgttgtggcaatctttgttgaccacgattgaccgtctgccccgtagc
atcaatcaacgtccacggttgtcagatagcttgtatcgtttattacaagtcgctgagttt
gttgcttctcaagaagcaggcaatgaatctattcgctcggtgcatttgttgcaggtgctg
cgtggtcagccggattggttgcgtactcacgatggttggccgttgatgagcctgagtgtg
agccagttacaacatttgcgcccgctgctggatcagcattcagcagagcgcccggaagta
caggcggcggcgcgtctggccgatagcggcgggggttctgcggtggcagaaatacatcct
gataaacctgctcaaaatgctcaagcgttatcaccagcgttacagggagtattagacaaa
ttcacactggatttaacggcgcgtgctgccgagggccgtattgatccggtgtttggtcgt
gacaatgaaattcgccaaatgatcgacattctgtcgcgcagacgtaaaaacaacccaatt
ttggtcggtgaaccgggggtaggaaaaactgcgctggtggaaggattggccttgcgtatt
gccggtggtcaggtgcctgatagcctgaaaaccgtcagtgtgcggtcgctggatctgggg
ctattgcaggcaggcgcgggggtaaaaggcgaatttgaacaacggctgaaaaacgtgatt
gaagcagtacaacagtcacccaccccaatcttactgtttattgatgaagctcatacgctg
attggctctggtaatcaggcaggcggcaccgatgcggctaacctgctcaaacccgcactg
gcgcggggagcattacgcacgattgccgccactacctggtcggaatacaaacaatatttt
gagcgggatgcggcactggaacggcgttttcagatgatcaaagtggacgaaccggatgat
gaaaccgcctgcctgatgctgcgtggtctgaaagcgcgctatgcccgttaccatggcgtt
catattcaggataacgccgttaaagcagcggttaccttatctcgccgttacctgaccggg
cgtcagctcccggataaagcagtggatttgctggataccgccagcgcccgggtgcggatg
agtctggatacggtgccggaagcattgacgcaacgtcaggcacaactaacggcccttgaa
atggagcaacaggcgattgaagcggattcggcggtgttgccgacagaagaagataacacc
cgtttaaaggagattgcggttcggcgtgaagaggttgcacgccagactgaacaactcaca
gcacagtatcagcgcgaaaagagcctggctcagcgccttctcgatttacgtcaacattca
cccaaaacacctgaactcagggaaggcatagcggagctggcagaattacagggcaatgag
ccattactttcattgaatgtcgatgtgcgtactgtcgcgacggtcgttgccgattggacg
gggataccgttaagcagtttgctaaaagacgaacaaaccggtttgttacatcttgagcag
tatttaggcgaccgggttatcggtcaggatatggcactgagggaaatcgctcaacgttta
cgtgcggctaaaaccggtttgacgccggaacaggggccattaggcgtctttctactggtg
gggccaagtggtgtggggaaaaccgaaaccgcactggcattggccgattgcctgtttggg
ggcgaacgttcactaattactatcaatttgtcggaatatcaggaaccgcatacggtttct
cagctgaaaggttcacctccgggttatgtggggtacggacagggcggcattttgacggaa
gcagtacgtcagcgcccctacagcgtcgtgttgttggatgaagtagaaaaagcgcatcgt
gacgtgttgaacctgttctatcaggtatttgatcgcggttttatgcgggatggtgaaggg
cgcgagatcgattttcgtcataccgtcatattgatgacctctaatctggggagtgatcaa
ctgatggcattattggcacaacagcctgatgctccgactgccacccagcacgaattgttg
cgtcccatactgcgtgatcactttcagccggcattgttggctcgtttccagaccgtgatt
taccgcccattatcggcggaagcgctcagacggattgtagacatcaaattggggcaagtc
acccggcgtctaaacacccattatggcctgacctgcacggtggaaagtggcctgtgcgac
acgctggtcaatgcctgtctgttgccggacagtggggcgcgcaatatcgacagcctgctc
aatcaacaaatcttaccggtgctatcgcaggcgctgctagaacgtctggcacatcaccat
aaacctgttggcgtaacgttaggtttcaatgaagaagaggggatcatccttgctttcact
gaacagactgccgtatctgatagcggggaaaatgcatga

DBGET integrated database retrieval system