KEGG   Photorhabdus asymbiotica: PAU_03834
Entry
PAU_03834         CDS       T00941                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pay  Photorhabdus asymbiotica
SSDB
Motif
Pfam: OmpA Competence DoxX_2
Other DBs
NCBI-ProteinID: CAQ85922
UniProt: C7BMP3
Position
complement(4457494..4459227)
AA seq 577 aa
MSCALRRALWLLACVLAAVLCWFFPLGKVSAALWLSVILVIAIIAWWQTGRAMREMSHQD
SVCRLLAALPAASWRQPVVLTCGENVTTLFTGEPLRITPQGCFICVPRQSEMSALVEAII
TARPDWCAQISVLLTLFPEQQQDQSVMTAQIREFRYQVACVAQLTACRPPVLIAGYLDGD
ISPWFELRADRPMMTVCCEKQAAIGMNIWLAEGDAQQRVVRLQQTVAVAAWQRWMVENVL
SECQSRDLTSQPCHPIAMALMFWPQTPQANNLWTKWLIAHTTLPRINRSIAGAVSVLPFP
DAMLRLLPGYYGYSPRRRAVVWAIGLLTGFACLALTASAWNNQRLLRQIRSDLQHYHAIS
MKDVGAKGLAYQQLKRDAALLEKYHRDGEPMRLGLGLYLGDHLYAPLMDVINHAVLPASP
PAQPKKDKALPRTLSLNSMSLFDVGQSRLKAGSAKVLMNALIDIKAKPGWLIVISGHTDS
TGNTEKNRVLSLARAEAVRDWLLQTSDIPLACFAVQGEGATRPVATNSTAAGRAANRRVE
IRLVPNAVACQRLQPVSGSLSTTTSPVQATSHTQKQE
NT seq 1734 nt   +upstreamnt  +downstreamnt
ttgagttgtgcattaaggcgagcgctatggcttttggcttgtgttttggctgcggtgctg
tgctggttcttcccgttgggaaaggtatctgctgcattgtggctatctgtaattctggtg
atagcgatcattgcctggtggcaaacagggcgtgctatgcgtgaaatgtcccatcaggac
agtgtttgtcgtttgctggcggcactaccagctgcctcatggcgtcagcctgtggtgctg
acctgtggtgagaatgtgacaaccttgtttacaggagagccgctgcgcatcactccacag
ggctgttttatctgcgtaccacgacaaagtgagatgagtgcgctggtggaagccattatt
acggccagacctgactggtgcgcgcagattagtgtgttgttaacactcttccctgaacag
caacaggatcagtcggtaatgacagctcagatccgggagtttcgttatcaggttgcttgt
gttgcacaactaaccgcctgccgtcccccggtgttaattgctggttatcttgatggtgat
attagcccgtggttcgaattgcgggcagatcgcccgatgatgacggtatgttgcgagaaa
caggccgccattgggatgaatatctggttggcagaaggagatgcacagcagcgcgttgta
cgtttacaacagacagttgccgttgcggcatggcaacgttggatggtggaaaacgttctg
agcgagtgtcagtcgcgggatctaaccagccagccttgtcaccccatcgcaatggcactg
atgttttggccccaaactccgcaggcaaacaatctttggacaaaatggctgattgcccat
acaactttaccccgcatcaaccgcagcatcgctggtgctgtgagtgtactgccatttcct
gatgcaatgttgcgcttgttgccaggttattacggctattcaccgcgccggcgtgcagta
gtttgggcgattggcttgctgacgggatttgcttgtctggcattaacagccagtgcttgg
aataaccagcgtttgctacgccagatacgtagtgatttacaacattaccatgctattagc
atgaaagacgttggtgctaaagggctggcttatcagcaactcaaacgcgacgcagcattg
ttggaaaaatatcatcgggatggtgaaccgatgcgtttggggctggggctttatttgggt
gatcacctttatgcgccgttgatggatgttatcaaccatgcggtattaccggcatcaccg
cctgcgcagccgaagaaagacaaagcgctgccgcggacgttgagtcttaacagcatgtca
ttattcgatgttggacaatcccgccttaaggccggatctgccaaagttctgatgaacgca
ttgatagatatcaaggctaaacccggctggctgattgtgattagcggtcataccgattcc
actggcaatactgagaaaaaccgcgtgttatcactggcgcgagcagaagcggtacgcgac
tggttattacaaaccagtgatattccgctcgcttgctttgccgtacagggcgaaggtgca
acgcggccagtcgccaccaattcaacggctgcggggcgagctgccaaccgcagagttgaa
atccgtctggtacctaacgcagtcgcctgccagcgactgcaaccagtgtcaggctcttta
tcaacaacaacgtcgccggtgcaggcgacatcacacactcaaaaacaggagtaa

DBGET integrated database retrieval system