KEGG   Photorhabdus asymbiotica: PAU_03867Help
Entry
PAU_03867         CDS       T00941                                 

Gene name
gntK
Definition
(GenBank) thermoresistant gluconokinase (gluconate kinase 2)
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00030  Pentose phosphate pathway
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
pay01130  Biosynthesis of antibiotics
pay01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAU_03867 (gntK)
Enzymes [BR:pay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     PAU_03867 (gntK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 APS_kinase Cytidylate_kin Cytidylate_kin2 Ploopntkinase1 DUF2075 AAA_17 AAA_16 AAA AAA_22 AAA_29 SMC_N CPT dNK PhoH
Motif
Other DBs
NCBI-ProteinID: CAQ85955
UniProt: C7BNA0
Position
complement(4503839..4504378)
Genome map
AA seq 179 aa AA seqDB search
MSDTHHSNHVFVLMGVSGSGKSAVASAVAYKLDIAFLDGDFLHPRSNINKMAEGHALNDE
DRKPWLKSLNDAVFAMQRTNLVSLIVCSALKKHYRDMLRDNNKNLSFLYMKGDFDLIESR
LKARKDHFFKPQMLISQFEALEEPNSDEKDVYPIDISSSLDEVINHSIKIINSIISGEN
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccatcattctaaccatgtttttgtgcttatgggggtatccggcagtggt
aaatctgctgttgctagtgctgtggcctataaattggatattgcttttttagatggcgat
tttttacatccaagatctaatattaataagatggctgaaggacatgcattgaatgatgaa
gatcgcaaaccttggttaaaatcattgaatgatgctgtttttgctatgcaacgcacaaat
ctggtttctttgattgtttgttctgctttaaaaaagcattaccgggatatgttgcgtgat
aataataagaatctatcatttctttatatgaaaggcgattttgatttaattgaaagtcgg
ttgaaagcacgtaaagatcatttttttaaacctcaaatgttgatatctcaatttgaggca
ttagaagaaccaaacagtgatgaaaaggatgtttatccgattgatattagctcgtctcta
gatgaagtgattaatcactcgataaaaataattaatagcatcatttcaggggaaaattaa

DBGET integrated database retrieval system