KEGG   Photorhabdus asymbiotica: PAU_03878Help
Entry
PAU_03878         CDS       T00941                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00860  Porphyrin and chlorophyll metabolism
pay01100  Metabolic pathways
pay01110  Biosynthesis of secondary metabolites
pay01120  Microbial metabolism in diverse environments
Module
pay_M00121  Heme biosynthesis, glutamate => heme
pay_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAU_03878 (hemB)
Enzymes [BR:pay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PAU_03878 (hemB)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAU_03878 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAQ85966
UniProt: C7BNB1
Position
complement(4523067..4524080)
Genome map
AA seq 337 aa AA seqDB search
MSYAFPGTFPGRRMRRVRRHDFSRRLVAENQLTVNDLIYPVFVMEGTNCRQEVPSMPGVY
RLTIDLLLKEAEEIARLGIPVLSLFPVIEADKKSLDAKEAYSPDGLIQRTIRTLKEAVPE
LGLLTDVALDPFTTHGQDGIIDQDGYVINDVTKDILVKQALSHAEAGAEIIAPSDMMDGR
IGAIREKLEEEGHVNTQIMAYSAKYASGYYGPFRDAIGSSSHLKGGNKKNYQMDPANSDE
ALQEIAQDLQEGADTVMVKPGMPYLDVIRRVKETFGVPTFAYQVSGEYAMHMAAIQNGWL
PEQVIMESLLCFKRAGADGVLTYFAKQVAQQLIEQRL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgagctatgcatttccaggcactttccctggtcgccgtatgcgtcgagtgcgccgccat
gatttttcccgtcgtttagttgctgagaatcaattaactgtcaatgacttaatctatcct
gtgtttgtgatggaagggactaactgtcgtcaggaagttccttctatgccaggggtgtat
cgtctgacaattgatcttttgttgaaagaagctgaagagattgcccggttggggattcct
gtattgtctctgtttcctgttattgaagcagataaaaaatctctggatgcgaaagaagct
tatagtcctgatggactaattcaacggactatacgcacgctgaaagaagcggttcctgaa
ctgggattattgactgatgtagcattagatccgttcactacacatggtcaggatggaatt
attgatcaggatggttatgtaattaatgatgttaccaaagatatcttggtcaaacaggcg
ctgtcacatgcggaggctggtgctgagattattgcgccaagtgacatgatggacggacgg
attggtgcaattcgagagaagcttgaagaggaaggtcatgtaaatactcagattatggct
tattccgctaagtatgcttctggttattatggtcctttccgtgatgctatcggttcaagt
agtcatctaaaaggtggtaataaaaagaattatcaaatggaccctgctaacagcgatgaa
gcgttgcaagagattgctcaggatttgcaggaaggcgctgatactgtgatggttaaaccg
ggtatgccttacctggatgttatccgtagggtaaaagagacatttggtgtcccaaccttt
gcttaccaagtatctggtgaatatgccatgcatatggctgctatccagaatgggtggtta
ccggaacaggtaattatggaatccctgttgtgtttcaagcgtgcgggagcagatggcgtg
ctgacatattttgcaaaacaggttgctcaacagttaattgagcagcggttgtaa

DBGET integrated database retrieval system