KEGG   Photorhabdus asymbiotica: PAU_03985Help
Entry
PAU_03985         CDS       T00941                                 

Gene name
pepA
Definition
(GenBank) probable cytosol aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00480  Glutathione metabolism
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAU_03985 (pepA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pay01002]
    PAU_03985 (pepA)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     PAU_03985 (pepA)
Peptidases and inhibitors [BR:pay01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   PAU_03985 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N SMC_N
Motif
Other DBs
NCBI-ProteinID: CAQ86073
UniProt: C7BP47
Position
4642787..4644307
Genome map
AA seq 506 aa AA seqDB search
MEFSVKSGSPEKQRSACIIVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKVGQSL
LLHHVPNVLSERILLIGCGKERELDERQYKQIIQKTINTLNETGSMEAVCFLTELHVKGR
NNYWKVRQAVETAKESLYVFDQLKSNKNELRRPLRKMVFNVPTRRELTSGERAIQHGLAI
AIGIKAAKDLSNMPPNICNAAYLASQARQLADSANSHITTKVIGEEQMKELGMNAYLAVG
QGSQNESLMSVMEYKGSSDKSAKPIILVGKGLTFDSGGISIKPAGSMDEMKYDMCGAATV
YGVMRVVAELQLPLNVIGVMAGCENMPGGRAYRPGDILTTLSGQTVEVLNTDAEGRLVLC
DALTYVERFDPELVIDIATLTGACITALGNHYSGLLSNHNPLAHELLNASEQSGDRAWRL
PMTDEFFEQIDSNFADLANTGGSAGGAITAACFLSRFATKYHWAHLDIAGTAWRSGKAKG
ATGRPVALLSQFLLNRAGSTGINNDD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggagtttagtgtaaaaagcggtagcccggaaaaacaacgcagtgcgtgtattattgtc
ggcgttttcgaacctcgccgcctatcccctattgccgaacaacttgataaaataagtgat
ggttatatcagcgccttgttgcgccgtggtgaattggaaggcaaagttggtcaatcactg
ctgctccaccatgttcccaatgtgttatctgaacgtattttgctcatcggctgcggtaaa
gagcgcgagctggacgaacgtcagtataaacaaattatccaaaaaactatcaataccctt
aatgaaaccggctcaatggaagcagtctgttttttaacagaattacatgttaaaggccgg
aataattactggaaagtacgccaagcggtagagacagcaaaagagtctctttatgttttc
gaccagcttaaaagtaataaaaatgagctgcgccgcccactgcgtaaaatggtgttcaat
gttcctacccgtcgggagctaaccagtggtgaacgtgcaatccaacacggtcttgccatt
gctatcggtatcaaagcagctaaagatcttagcaatatgccaccaaacatctgtaacgca
gcttatctggcctctcaagcccgtcagctcgcagattctgctaatagccacattacaaca
aaagtaattggtgaagaacagatgaaagagttgggaatgaacgcttatctggccgttggt
cagggttctcagaatgaatccctgatgtcagtcatggaatataaaggcagctctgataaa
agtgccaaaccgatcatcctggttggcaagggcctgacttttgactccggtggtatttca
atcaaacctgctggtagcatggatgagatgaaatacgatatgtgtggcgctgcaacagtt
tatggtgttatgcgtgtggttgctgaactacagctaccactcaatgtcatcggtgtcatg
gccggctgtgagaatatgccaggaggtcgtgcttaccgaccaggagatattttaaccacc
ctatctggtcaaacggtcgaagtgctcaatactgatgcagaaggccgtctggttctgtgt
gatgcattaacttacgtcgaacgttttgatccagaattggtcattgatatcgccacactg
accggtgcttgcatcaccgctcttggtaatcattacagtgggttactatccaaccataat
ccactggctcacgagctactaaatgcttcagaacaatccggtgatcgcgcatggcgcctg
ccaatgaccgatgaatttttcgagcaaattgattccaattttgccgatctggcaaatact
ggtggcagtgcgggtggtgcgattacggctgcctgcttcctgtcccgcttcgcaacaaaa
tatcattgggcacatctggatatcgccggtactgcatggcgttcaggtaaagcgaaaggt
gcaacaggtcgcccagttgcactattgtcacaattcctgttaaatcgtgctggtagtaca
ggtatcaataacgacgattga

DBGET integrated database retrieval system