KEGG   Photorhabdus asymbiotica: PAU_04353Help
Entry
PAU_04353         CDS       T00941                                 

Gene name
hldD
Definition
(GenBank) ADP-L-glycero-d-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00540  Lipopolysaccharide biosynthesis
pay01100  Metabolic pathways
Module
pay_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    PAU_04353 (hldD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pay01005]
    PAU_04353 (hldD)
Enzymes [BR:pay01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     PAU_04353 (hldD)
Lipopolysaccharide biosynthesis proteins [BR:pay01005]
 Unusual sugar
  PAU_04353 (hldD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: CAQ86440
UniProt: C7BT06
Position
5013444..5014418
Genome map
AA seq 324 aa AA seqDB search
MLRITLLIEVSPMIVVTGGAGFIGSNIVKALNDEGYKDILVVDNLKDGTKFANLADLDIA
DYMDKEEFLIGILAGDDLGDIDAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLDRK
IPFLYASSAATYGGRSDNFIEERQYEKPLNVYGYSKFLFDQYVRELLPHADSQICGFRYF
NVYGPREGHKGSMASVAFHLNNQINQGQNPKLFAGSENFQRDFIYVGDAAAVNLWFWKNG
VSGIYNCGTGRAESFQAVADAVVEFHKDKSPTVEYIDFPEHLKGRYQSFTQADLTNLRAA
GYDKPFKTVAEGVTEYMHWLNQDK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgcttcgtataaccctgttgattgaggtgagtccgatgatagttgttactggcggtgct
ggatttattggcagcaatattgttaaggcactgaatgacgaaggatataaagatattctg
gtcgtagataatctaaaagatggtactaagttcgccaatttggctgacctggatattgct
gattacatggataaggaagagtttcttattggtatcctggccggtgatgatttaggtgat
attgatgctatttttcatgaaggtgcttgttcatccacaaccgagtgggatggcaagtat
atgatggataataactatcaatattcaaaggaattattgcactattgcctcgatcgtaaa
attcctttcctttatgcctcttcagcagcaacttatggcggccgcagtgataactttatt
gaagagcgtcaatatgagaaaccacttaatgtttatggttactctaagtttctgttcgat
cagtatgtccgggaacttttacctcacgctgattcacagatttgtggtttccgttatttc
aatgtgtatggaccacgagaaggacacaaaggcagtatggccagtgttgcattccatcta
aacaatcaaatcaatcagggacaaaacccgaaattattcgcgggcagtgaaaactttcaa
cgtgattttatttacgttggcgatgccgctgcggttaacctgtggttctggaaaaatggc
gtttctggtatttataactgtgggacgggtcgcgctgaatctttccaagcggttgcagat
gcagtggttgaattccataaagataaatcgccaaccgttgaatatattgattttcctgaa
catttgaaaggtcgttatcagagcttcactcaagcagatctgactaacctccgcgcagct
ggttatgataaaccattcaaaacagttgccgaaggcgtaacggaatatatgcattggctc
aatcaggataagtaa

DBGET integrated database retrieval system