KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_03130Help
Entry
TIA2EST2_03130    CDS       T01656                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00300  Lysine biosynthesis
paz01100  Metabolic pathways
paz01120  Microbial metabolism in diverse environments
paz01230  Biosynthesis of amino acids
Module
paz_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TIA2EST2_03130
Enzymes [BR:paz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TIA2EST2_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: AEW78725
Position
683771..684850
Genome map
AA seq 359 aa AA seqDB search
MDLKPTGDLHELFRRLVDIESVSMHEAPIADAVEETLAPHRHLEVTRLGNSVIARTHLGR
SERVVIAGHLDTVPVVENLPSYIEQRSDGDYLVGRGTCDMKGGIAVALALAVSLENPVRD
VTWAFYECEEIAAEHNGLEKIASWRPDLIDGDFAILMEPTDGRVEGGCQGTMRFTLEVPG
RAAHSARSWVGHNAIHDLSAVLERLNRWQERDPFVEVDGLTFREGLNATMLDAGVAGNVI
PPTATIQINYRFAPDKTTEQARQYMEDLFHEWPMNVLDLSAPARPGLDRPLAKSFVAAVG
GEPGPKYGWTDVARFGQLGIPAVNFGPGNALCAHQVDECCRLGSLDECYRALHTWLASR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaagccgacgggcgacctgcacgagctctttcgtcgactcgtcgacatcgag
tcggtgtccatgcacgaggcgcctattgccgatgctgtggaggagacgttggcaccacat
cggcatcttgaggtgacgagactcggtaactctgtcattgcccgtactcaccttgggcgt
tcggaacgggtcgtcattgctggtcacctcgacaccgttccggtcgtcgagaacttgccg
tcctatattgagcagcggtcggacggggattacctcgtgggtaggggcacgtgcgacatg
aagggcggtatcgccgtcgcgctcgccttggctgtgagccttgagaatccggtgagggat
gtcacttgggcgttctatgagtgtgaggagatcgcggccgagcacaacggtctggagaag
attgcctcttggcgccctgacctcatcgacggtgacttcgccatcctcatggaacccacc
gatggccgggtggagggtggttgtcagggaaccatgcgtttcacccttgaggtgccgggg
cgggcggcccattcagctcgttcgtgggtcgggcacaatgcgatccatgatctgtccgcc
gttttggagcgtctcaaccgctggcaagaacgggacccgtttgttgaggttgacgggctg
accttccgtgagggcctcaatgcgacgatgctcgacgccggtgtggccggtaacgttatt
ccccccaccgctactattcagattaattatcggttcgcccccgacaagacgaccgaacag
gctcggcagtacatggaggatctcttccatgagtggccgatgaacgttcttgacctgtcg
gctcccgccagaccagggctcgatcgtccgttggcgaagtctttcgttgctgcggtgggc
ggggaaccgggtcctaagtacgggtggaccgacgttgcccgtttcgggcaactcggaata
ccggctgttaacttcgggccggggaatgcgctgtgcgctcatcaggtggatgagtgttgt
cgtcttggctcactggatgagtgctaccgggcgctgcacacgtggttagcgtcgcgatga

DBGET integrated database retrieval system