KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_03580Help
Entry
TIA2EST2_03580    CDS       T01656                                 

Definition
(GenBank) Putative sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00010  Glycolysis / Gluconeogenesis
paz00052  Galactose metabolism
paz00500  Starch and sucrose metabolism
paz00520  Amino sugar and nucleotide sugar metabolism
paz00521  Streptomycin biosynthesis
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
Module
paz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIA2EST2_03580
   00052 Galactose metabolism
    TIA2EST2_03580
   00500 Starch and sucrose metabolism
    TIA2EST2_03580
   00520 Amino sugar and nucleotide sugar metabolism
    TIA2EST2_03580
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TIA2EST2_03580
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TIA2EST2_03580
Enzymes [BR:paz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TIA2EST2_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: AEW78811
Position
776648..777718
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPGNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggttgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaattggctcgtaacctccctatctgtgctgta
ggcatcggggcagccggctggatagacactgaacaggcgctcgtgcggttttccccgcat
ttagcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggccgcgtgggctgagttccggttcggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcctcc
ggaaattccctcgtgagggatgctcgagcgttgcttgccgagggagctcccggtgctcag
gatctgttgggttatgtagctgaccgcaatccgggcaacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgccattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggccgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgtccgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggtccggttgttcgggacaagtga

DBGET integrated database retrieval system