KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_06160Help
Entry
TIA2EST2_06160    CDS       T01656                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00260  Glycine, serine and threonine metabolism
paz00750  Vitamin B6 metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01230  Biosynthesis of amino acids
Module
paz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:paz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIA2EST2_06160
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TIA2EST2_06160
Enzymes [BR:paz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TIA2EST2_06160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEW79319
Position
complement(1327058..1328134)
Genome map
AA seq 358 aa AA seqDB search
MIMSQQNRLFGVIETYRDRLPMDGIDQIVTLGEGATPLVPAPRLGAELDATVWVKVEGAN
PTGSFKDRGMTMAMTKALADGSKAVVCASTGNTSASASAYASRAGMTPVVLLPQGKIAAG
KLAQAVVHGGRIIQILGNFDDCLRIARELAENFPVSLVNSINPYRIEGQKTAAFEVVDVL
GDAPDIHALPVGNAGNITAYWKGYREYVADGPASHTPRMFGFQAAGAAPLVLGHDVNDPE
TVATAIRIGRPASGKLALAARDESEGLIDAVTDEQILDAQTFLAAREGIFVEPASAVGVA
GLFKLKSEGRLDPGLRIVVTVTGNGLKDIDTALSRTTWSTEAVEASTDQVAALLDFCS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatgagccagcagaatcgtctcttcggcgtgattgagacctatcgagaccgtctc
cctatggacggaattgaccagatcgtgacgttgggggagggggcgaccccgttggtgcct
gccccacgattgggcgccgagcttgacgcgacggtatgggttaaagttgaaggggccaat
ccgaccggatcgttcaaggatcgtggcatgacgatggccatgacgaaagcccttgccgac
ggctcgaaagccgtggtgtgtgcctctaccggtaatacctctgcctcggcatcggcttac
gcctcccgagccggcatgactccggtcgtgctccttccccagggcaagattgcagctggc
aaactcgcccaggctgttgtccatggcggtcgaatcatccagattctcggcaacttcgac
gattgcctgcgtattgcccgcgagctggccgagaatttcccggtctccctggtgaactcg
atcaatccgtaccgcatcgagggacagaaaactgctgcctttgaggtcgttgacgttctt
ggtgacgctcctgatatccacgctcttccggtgggcaacgcaggcaatatcaccgcctat
tggaagggttaccgcgagtacgtagcggacggtcctgccagccacacgccgcggatgttc
ggattccaagccgctggcgcagcccccctggtgctgggccacgacgttaatgacccggaa
acggtagccaccgctattcgtatcggtcgtccggcctccggcaagctggcgttggccgct
cgagacgagtcggaggggctcatcgacgctgtcacggacgagcaaattcttgacgcccag
actttcctagctgctcgagagggcatttttgttgagccggcatcagcagtcggagtggca
ggtttgttcaagttgaagtccgagggacgcctggatcctggactgcgcatcgtcgtcacg
gtaactggaaacggtctgaaggacattgacactgcattgagtcgcactacctggtcaacc
gaggctgtggaagcttcgactgaccaggttgccgctttgttggacttctgttcctga

DBGET integrated database retrieval system