KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_07620Help
Entry
TIA2EST2_07620    CDS       T01656                                 

Definition
(GenBank) methyltransferase domain protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Brite
KEGG Orthology (KO) [BR:paz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paz03009]
    TIA2EST2_07620
Enzymes [BR:paz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     TIA2EST2_07620
Ribosome biogenesis [BR:paz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    TIA2EST2_07620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_4 Methyltransf_33
Motif
Other DBs
NCBI-ProteinID: AEW79607
Position
1631031..1631852
Genome map
AA seq 273 aa AA seqDB search
MTPTLSVVLPWLICPTCQRRGCENPLARDGRSLRCPEHHCLDIAKQGYVTMTSTPAGANA
DTVEMIAARQRVLDAGLFGDLDARLAEILIGRDRIVEVGAGTGHHLAQVLEAHPDSHGLA
SDVSKAAIRRAAKAHPRMAAVVADTWAGLPIRTGCIDAGLCVFAPRNRDEFARIMKPDGI
FVVVTPLPDHLQQLRERTGMIGIQPHKHDELMAALASRFTVIGHEEVRADIPLDKQTASD
AVAMGPSAHHIHNVHVDAMSITSAVEVTVLSPR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgacactttccgtagtcctgccgtggctgatctgtcccacctgtcagcggcgc
ggctgtgaaaacccgttggcccgtgatgggaggtctctgcgatgccccgagcaccactgt
ctcgatatcgccaagcagggctacgtcaccatgacaagcaccccggccggtgctaatgcg
gacaccgtcgagatgatcgctgcccgccaaagggtgttggacgccgggctgttcggtgac
cttgatgctcggctggccgagattctcatcggccgagatcgcattgtggaagtaggagct
ggaaccggtcaccatctggcccaggttctcgaggcccaccccgattcccacggtctggca
tctgacgtctcgaaagcagctatccggcgggcggcgaaagctcatcctaggatggcggca
gtggttgccgatacctgggctgggctgcctatccgcactggctgtatagatgctgggctg
tgcgtctttgcgcctcgcaaccgtgacgagttcgcgcgcatcatgaaacctgacgggatc
ttcgtcgtcgtcaccccgctaccggaccatttgcaacagctgcgtgaacgcaccgggatg
atcggcatccagccccacaagcacgacgagctcatggcagctttggcatcacggtttacc
gttatcggccatgaagaggtgcgagcggacattcctctggacaaacagacggcctctgac
gctgtggcaatggggcctagcgcccaccacatccacaacgttcatgtcgatgccatgtcc
atcacgtcagctgtggaagtgacggttctgtctccccggtga

DBGET integrated database retrieval system