KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_08120Help
Entry
TIA2EST2_08120    CDS       T01656                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00670  One carbon pool by folate
paz00790  Folate biosynthesis
paz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIA2EST2_08120
   00670 One carbon pool by folate
    TIA2EST2_08120
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TIA2EST2_08120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AEW79700
Position
complement(1768627..1769097)
Genome map
AA seq 156 aa AA seqDB search
MKVVAIAAVADNGVIGSGQDMLWHISEDFRRFKTVTMGHTLIFGRRTFEQIGKLPGRRHI
ICTRDPHWSHEGVDVATSPRQAVEMAREAGEEICFVAGGGQIYADAFELCDELDITEVHQ
NPNGAARFPAIDPEVWVEVRRESRDGFDFVGYRRRA
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtcgctatcgccgccgttgctgataacggcgtcatcgggtcggggcaggat
atgctctggcacattagtgaggatttccgtcgttttaagactgtgacgatgggtcacaca
ttgatctttgggcgtcgtacctttgaacagatcggcaagcttcctgggcgtcgtcacatc
atctgcacccgcgacccgcactggtcccatgagggggtggacgtcgcaaccagcccgcgt
caggccgtcgagatggcgcgtgaggcaggcgaggagatctgttttgttgccggaggtgga
cagatctacgccgacgctttcgagttgtgcgacgagctcgacatcaccgaagtccaccag
aatccgaatggtgcggcgcgtttccccgccattgaccctgaggtgtgggtggaggttcgt
cgtgagtctcgtgacggcttcgatttcgtcgggtaccgacgccgggcatga

DBGET integrated database retrieval system