KEGG   Pseudomonas azotoformans: AYR47_03730Help
Entry
AYR47_03730       CDS       T04879                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AYR47_03730
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pazo03011]
    AYR47_03730
Ribosome [BR:pazo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AYR47_03730
  Bacteria
    AYR47_03730
  Archaea
    AYR47_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMN77493
UniProt: E2RXU8
Position
complement(785112..785444)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcagt
aagaaagccgccgagatcatgaagaaagtgctggagtcggccgtagccaacgccgagcat
aacgaaggcgcagacgttgatgacctgaaggtcagcaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccacgtgccaaaggccgtgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system