KEGG   Pseudomonas azotoformans: AYR47_04075Help
Entry
AYR47_04075       CDS       T04879                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pazo  Pseudomonas azotoformans
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AYR47_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LuxE
Motif
Other DBs
NCBI-ProteinID: AMN77551
UniProt: A0A127HT49
Position
853215..853595
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVVTRFLADQSQPEHNRFAFAYTITVKNNGLVPAKLLSRHWVITDGDGQV
EEVRGAGVVGQQPLIDSGASHTYSSGTVMTSKVGTMQGSYQMKATDGQLFDAIIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgctaccagatcgacgtcagcgtcgtcacccgcttcctggcggaccaa
tcccaacctgaacacaaccgcttcgcctttgcctacaccatcacggtgaaaaacaacggg
ctggtgccggccaagctgctgtcgcgccactgggtgatcaccgacggtgacggtcaggtc
gaagaagttcgcggggctggcgtggtgggtcagcaaccgttgatcgacagtggcgccagc
catacctacagcagcggcacggtaatgacctccaaagtcggcaccatgcaaggctcgtat
caaatgaaagccaccgatggccaactgttcgacgccatcatcgcgcccttccgcctcgcc
gtgccgggagccctgcactga

DBGET integrated database retrieval system