KEGG   Pseudomonas azotoformans: AYR47_06520Help
Entry
AYR47_06520       CDS       T04879                                 

Definition
(GenBank) pyruvate carboxylase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00020  Citrate cycle (TCA cycle)
pazo00620  Pyruvate metabolism
pazo01100  Metabolic pathways
pazo01120  Microbial metabolism in diverse environments
pazo01200  Carbon metabolism
pazo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AYR47_06520
   00620 Pyruvate metabolism
    AYR47_06520
Enzymes [BR:pazo01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AYR47_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AMN78003
UniProt: A0A127HU42
Position
complement(1387367..1388782)
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAVYSDADRHALHVKRADEAHSIGAEPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELADICAERGIKFIGPSAEVIRRMGDKTEARR
SMIKAGVPVTPGTEGNVADIHEALTEGDRIGYPVMLKATSGGGGRGIRRCNSREELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLSVRAAKAVGYENAGTVEFLLAEGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLPLSVKQEDIQHRGFALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPFYDSMCLKLVVWALTWEEAMDRGLRALDDMRLQGVKTTAAYY
QEILRNPEFRSGQFNTSFVEAHPELTNYSIKRKPEELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaagatcctgatcgccaaccgtggtgaaattgccgtacgcatcgtgcgtgcc
tgcgccgagatgggcattcgctcggtcgcggtctactccgacgccgaccgtcacgctttg
cacgtcaagcgtgccgacgaagcccacagcattggcgccgagcccctggccggttacctg
aacccgcgcaagctggtgaacctggcggtggaaaccggttgtgacgcgctgcaccctggc
tacggcttcctgtcggaaaacgccgaactggcggatatctgcgccgaacgtggtatcaaa
ttcattggtccgtcggcggaagtgatccgccgcatgggcgacaagaccgaagcgcgccgc
agcatgatcaaggctggtgtgccggtcacgccgggcaccgaaggcaacgtcgcggatatc
catgaggccctcaccgaaggcgaccgcatcggttacccagtgatgctcaaggccacttcc
ggtggcggcggccgtggtatccgtcgttgcaacagccgcgaagaacttgaacaagccttc
ccccgtgttatctccgaagccactaaggccttcggttcggcggaagtgttcctggaaaaa
tgcatcgtcaatcccaagcacatcgaggcgcagatcctcggtgacagcttcggcaacgtg
gtgcatctgttcgagcgcgattgctcgatccagcgtcgtaaccagaagctcatcgaaatc
gctccaagcccgcaactgaccccagaacagcgcgcctacatcggcgacctgtcggtacgc
gccgccaaggcggtgggctacgagaacgctggcaccgtggagtttctgctcgccgagggc
gaggtgtacttcatggagatgaacacccgcgtgcaggtggaacacaccatcaccgaagaa
atcaccgggatcgacatcgtccgcgagcagatccgcatcgcctcgggcctgccgttgtcg
gtgaaacaggaagacatccagcaccgtggtttcgcgttgcagttccgcatcaacgccgaa
gacccgaaaaacaacttcctcccaagcttcggcaagatcacccgttactacgcacccggc
ggccccggcgtgcgcaccgacacggcgatctacaccggttacaccatcccgccgttctac
gactccatgtgcctgaaactggtggtgtgggcgttgacctgggaagaagccatggaccgc
ggcctgcgtgccctggacgacatgcgcctgcaaggcgtgaagaccaccgccgcttactac
caggaaatcctgcgcaacccggaattccgcagcggccagttcaacaccagcttcgttgaa
gcccaccctgaactgaccaactactcgatcaagcgcaaacccgaagagctggccctggcc
atcgccgccgccatcgccgcccacgcaggcctgtga

DBGET integrated database retrieval system