KEGG   Pseudomonas azotoformans: AYR47_23125Help
Entry
AYR47_23125       CDS       T04879                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00040  Pentose and glucuronate interconversions
pazo00053  Ascorbate and aldarate metabolism
pazo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AYR47_23125
   00053 Ascorbate and aldarate metabolism
    AYR47_23125
Enzymes [BR:pazo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AYR47_23125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMN81019
UniProt: A0A127I2K3
Position
5049321..5050892
Genome map
AA seq 523 aa AA seqDB search
MTLTGKMLIGQQLISGNREAIRAINPATDTPMEPAYPGGDGEQVAQACALAWAAFDKYRE
TSLEARASFLEAIATQIEALGDELIERAVAETGLPHARIQGERGRTCGQLRTFARTVRAG
EWLDVRVDPSQPQRQPLPRPDLRQRHIALGPVAVFGASNFPLAFSVAGGDTASALAAGCP
VVVKAHGAHPGTSELVGRAVAQAVKACGLPEGVFSLLYGSGREVGIALVTDPRIKAVGFT
GSRSGGVALTQAAQARPEPIPVYAEMSSINPVYLFPAALTTRGEALAKGFVASLTQGAGQ
FCTNPGLVIAVQGPALDRFIGTASEMLPNCAAQTMLTPGIFSAFDAGVAALTEHAKVAAK
GLPAEGPNRGQAHLFVTQAKDFLANEHLQAEVFGAASLIVVCANNQEMHQVSEHLEGQLT
ATLQMDDEDLPSAKALLPLLERKAGRLLVNGWPTGVEVCDAMVHGGPFPATSDSRSTSVG
TAAIQRFLRPVCYQDFPDALLPAALQHGNPLLLRRLLDGQREA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgactctgacgggcaaaatgctgatcggtcagcaactcatttccggaaaccgcgaggcg
atccgggcgatcaatcccgccaccgatacccccatggaaccggcctatccaggcggcgac
ggcgaacaggtggcccaggcgtgtgccttggcgtgggcggcgtttgataagtaccgcgaa
acgtcgctggaggcgcgtgccagctttcttgaagccatcgccacgcagatcgaagccctg
ggtgatgagctgatcgaacgtgccgttgccgaaaccggcctgccccacgcgcgcatccaa
ggcgaacgcgggcgcacctgcggccaactgcgcacctttgctcgcaccgtacgcgccggg
gaatggctggatgtgcgggtggacccttcacagccgcaacgccagccactgcctcgtcca
gacctgcgccagcgccatatcgcgctgggcccggtggccgtgttcggtgcgagcaatttc
cccctggcgttttccgtagccggtggcgacaccgcctccgcgctggccgccggttgccca
gtggtggtcaaggcccatggcgcgcatccgggcaccagtgaactggtgggccgggcggtg
gcgcaggcagtcaaggcttgtggcttgcccgaaggcgtgttttcgctgttgtacggttcg
ggacgcgaggtggggattgcgctggtcaccgatccgcgcatcaaggcggttggtttcacc
ggctcgcgcagcggtggcgtggcgttgacccaagcggcgcaggcccggcccgagccgatt
ccggtgtatgcggagatgagttcgatcaatccggtgtatctgttcccagccgcactcacc
acacgcggtgaagcgttggcgaaaggctttgtggcgtcgctgactcagggtgccgggcag
ttttgcaccaacccaggtttggtgatcgccgtacaagggcccgcgctggatcgttttatc
ggcacggccagtgaaatgctgcccaactgtgcagcgcagaccatgctgacccccggcatt
ttcagtgccttcgatgcaggcgtggccgcactgacagaacacgccaaggtggcggcaaaa
gggttgccagcagaaggccccaacagaggccaagcccacctgttcgtgactcaggccaag
gattttttagccaatgaacacctgcaagccgaagtcttcggcgccgcttcattgatcgtc
gtatgcgccaataaccaagagatgcatcaggtttccgagcacttggagggccaactgacc
gccaccttacagatggatgacgaagatctgccaagcgccaaagccctgctgccgttgctt
gagcgcaaggccgggcgcctgctggtcaatggttggccgacgggtgtggaagtctgtgat
gccatggtgcatggcggccccttccccgccacgtcagactcgcgcagcacctcggtgggc
acggcggcgatccaacggtttttgcgaccggtgtgttatcaggacttccccgatgcgctg
ttgcctgctgcactccagcacggcaacccgttgctgctgcggcgcctgctcgatggccag
agggaggcgtag

DBGET integrated database retrieval system