KEGG   Pseudomonas azotoformans: AYR47_26625Help
Entry
AYR47_26625       CDS       T04879                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00970  Aminoacyl-tRNA biosynthesis
pazo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AYR47_26625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pazo03029]
    AYR47_26625
Enzymes [BR:pazo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AYR47_26625
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AYR47_26625
Mitochondrial biogenesis [BR:pazo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AYR47_26625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AMN81663
UniProt: A0A127I4N5
Position
5809239..5810645
Genome map
AA seq 468 aa AA seqDB search
MSEIGQLTAVQLLQHFRDKTLSPVEVTEDALLRIERFNPVVNAYCHVDPQGALNAARASE
QRWLNGQPCGPLDGVPSSIKDLTLTIGMPTRKGSRTSSAEGPWDIDAPFPAFMRKAGAVL
LGKTTTPEFGWKGVTDNPLYGITRNPWDTRTTAGGSSGGAGAAAALNLGVLHQGSDAGGS
IRIPCAFTGTFGIKPTFGYVPQWPASSMTILSHLGPMTRTVEDSVLMLQTIAQPDARDGL
IGAPRTTPWLTPGTDLKGLRVAYSPNFGYVEVDPQVAKVVADAVRGLEQLGAHVEQIDPG
FSDPLDVFSTLWAAGAARLTGAMSETQKQLLDPGLLRIAQRGERLSLDDFNAALEARAAL
VARMAAFHEHYDVLVSPMMPITAFEAGHNVPPSSGLQEWTQWTQFTYPFNLTQQPAASVP
CGLAANGLPVGLHVVGARFADEQVLRVCQVYAKAFPTKHLQAPITKPL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagatcggccaactgacggcggtgcaactgctgcagcattttcgcgacaagacc
ttgtcgccggtggaagtcaccgaggatgccctgctgcgtatcgaacgcttcaatccggtg
gtgaatgcctattgccacgtggacccgcaaggcgcgctgaacgccgcgcgcgcctcggaa
caacgctggctcaacggccagccctgcggcccgttggacggcgtgccctcttcgatcaag
gacctgacgctgaccatcggcatgccgacccgcaagggctcacgcacctcatccgccgag
gggccgtgggacatcgacgcgcccttcccggcctttatgcgcaaggccggtgcggtactg
ttgggcaaaaccaccaccccggaattcggctggaaaggcgtcaccgacaacccgttgtat
ggcatcacccgaaacccctgggacacccgtaccacggcaggcggttcgtccggcggcgcg
ggcgcggcggcggcgttgaacctgggcgtgctgcaccagggcagcgatgcgggcggttcg
atccggattccctgtgcgtttactggcacttttggcattaagccgaccttcggttatgta
ccgcaatggccggccagttccatgaccatcctgtcgcacctggggccgatgacccgtacg
gtggaagacagcgtcttgatgctgcaaaccatcgcccagccggacgcacgggatggcttg
atcggtgctccacgcaccacaccatggttgacgccgggtacggatttgaaagggttgcgc
gtggcctacagtccgaacttcggttacgtagaggtcgacccacaagtggccaaagtggtg
gcggacgcggtgcgaggcctggaacaactgggcgcccacgtcgagcagatcgaccccggt
ttcagtgacccactggacgtcttcagcaccctatgggcagccggcgcggcacgcctgacc
ggcgccatgagcgagacacaaaaacaactgctcgaccccggcctgctgcgcatcgcccaa
cgcggcgaacgcttgagcctggacgacttcaacgcagcccttgaagcccgcgccgcactg
gtggcacgcatggcggcgtttcatgaacactacgatgtgctggtgtcgccgatgatgccg
atcacggcattcgaggccgggcacaacgtaccacccagctccggtttacaggagtggaca
caatggacgcaattcacctaccccttcaacctgacccagcaaccggcggcatcggtgccg
tgtgggttggcggcaaatggcttacccgtggggttgcatgtagtaggcgcacgatttgcc
gacgagcaggtgttgcgggtgtgccaggtatatgcaaaagcattccccacaaagcactta
caagccccaatcaccaaacccctgtag

DBGET integrated database retrieval system