KEGG   Pseudomonas azotoformans: AYR47_30110Help
Entry
AYR47_30110       CDS       T04879                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00071  Fatty acid degradation
pazo00072  Synthesis and degradation of ketone bodies
pazo00280  Valine, leucine and isoleucine degradation
pazo00310  Lysine degradation
pazo00362  Benzoate degradation
pazo00380  Tryptophan metabolism
pazo00620  Pyruvate metabolism
pazo00630  Glyoxylate and dicarboxylate metabolism
pazo00640  Propanoate metabolism
pazo00650  Butanoate metabolism
pazo00900  Terpenoid backbone biosynthesis
pazo01100  Metabolic pathways
pazo01110  Biosynthesis of secondary metabolites
pazo01120  Microbial metabolism in diverse environments
pazo01130  Biosynthesis of antibiotics
pazo01200  Carbon metabolism
pazo01212  Fatty acid metabolism
pazo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AYR47_30110
   00630 Glyoxylate and dicarboxylate metabolism
    AYR47_30110
   00640 Propanoate metabolism
    AYR47_30110
   00650 Butanoate metabolism
    AYR47_30110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AYR47_30110
   00072 Synthesis and degradation of ketone bodies
    AYR47_30110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AYR47_30110
   00310 Lysine degradation
    AYR47_30110
   00380 Tryptophan metabolism
    AYR47_30110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AYR47_30110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AYR47_30110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AYR47_30110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pazo04147]
    AYR47_30110
Enzymes [BR:pazo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AYR47_30110
Exosome [BR:pazo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AYR47_30110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMN82299
UniProt: A0A127I631
Position
complement(6553059..6554264)
Genome map
AA seq 401 aa AA seqDB search
MTQALIFDAIRTPRGKGKADGALHSVKPVNLVAGLLTALTRRSDLDTHHVDDIVLGCVTP
IGDQGTDIAKTAALVADWDISVAGVQINRFCASGLEAVNLGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWVLDPQTNMHSHFTPQGIGADLIATLEGFTREDVDTFALHSQQKAARA
RADGSFNKSLIAVQDQNGIVLLDHDEFIRGDSTLEGLGKLKPSFEMMGQMGFDATALRVY
SHVERIHHVHTPGNSSGIVDGAALMLIGSEAKGRELGLQPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRVEDIDLFEVNEAFASVVLKFIKDMGIDAARVNVNGGSIAMGHPLG
ATGCAILGTLLDELEVRQQRYGLATLCVGGGMGIATIIERL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagctttgatctttgatgcgatacgcacgccccgtggcaaaggcaaggcggat
ggtgccctgcacagcgtcaagccggtgaacctggtggccggcctgctcacggcgctgacc
cggcgcagcgacctcgacacccaccacgtagacgacatcgtgctcggctgcgtaaccccg
ataggcgaccagggcaccgacatcgccaagaccgctgctttggtggcggactgggacatc
agcgtcgccggtgtgcagatcaaccgtttctgcgcgtcgggcctggaagccgtcaatttg
ggtgcgatgaaagtgcgttccggcttcgaagacctggtggtggtcggtggcgttgagtcc
atgtcccgtgtgcccatgggcagtgacggtggcgcctgggtactcgatccgcagaccaat
atgcacagccacttcaccccacagggtatcggcgcggacctgattgccaccctggaaggg
ttcacccgtgaagacgtcgacactttcgccctacattcccaacagaaagcggcgagggcg
cgggcggacgggtccttcaataaatcgctgatcgcggtgcaggaccagaacggcattgtg
ctgctggaccatgacgagttcatccgtggcgactcgaccctggaaggcttgggcaagctc
aagcccagcttcgaaatgatggggcagatgggtttcgacgccaccgcgctgcgggtctac
agccatgtggagcgcattcaccatgtgcacacaccgggcaacagctccggcatcgtcgat
ggtgccgcgttgatgttgatcggctctgaggccaagggccgcgagctgggcctgcaaccc
cgtgcgcgtatcgtcgccacggcggtcaccagtactgacccgaccatcatgctcaccggc
cccgcgcccgcgacgcgcaaggccctggccaaggccgggttgcgcgttgaagacatcgac
ctgttcgaagtcaacgaagccttcgcctccgtggtgctcaagttcatcaaggacatgggc
atcgacgcggcgcgagtcaacgtgaatggcggctccatcgccatgggccatccgctgggc
gccaccggttgcgccatcctcggcaccttgctcgacgaactggaagtgcgccagcagcgc
tacggcctggccaccctgtgtgtcggcggtggcatgggcatcgccaccattatcgaacgc
ctctga

DBGET integrated database retrieval system