KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a12Help
Entry
PSEBR_a12         CDS       T01472                                 

Definition
(GenBank) Glycine--tRNA ligase, alpha subunit (Glycyl-tRNA synthetase)
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pba00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PSEBR_a12
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pba01007]
    PSEBR_a12
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pba03016]
    PSEBR_a12
Enzymes [BR:pba01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     PSEBR_a12
Amino acid related enzymes [BR:pba01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   PSEBR_a12
Transfer RNA biogenesis [BR:pba03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PSEBR_a12
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AEA66128
UniProt: F2KAC9
Position
complement(15531..16484)
Genome map
AA seq 317 aa AA seqDB search
MSQPTPAVRTFQDLILALQQYWAEQGCVVLQPYDMEVGAGTFHTATFLRAIGPETWNAAY
VQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSLKHVGLDPLVHDIRFVE
DNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGEITYGLERLAMYLQGVD
SVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVEKLFELFDFYESEAKRLIELDQ
PLPLPSYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLARSVAQAYLLARAKLGFPM
ATPDLRDEVLAKLEAAQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcctacgccagccgtgcgtaccttccaagacttgatcctcgccctccagcaa
tactgggccgagcaaggttgcgtggtacttcagccctacgatatggaagtaggcgccggc
actttccacactgccacgtttctgcgtgccatcggcccggaaacctggaacgccgcttat
gtgcagcccagccgccgcccgactgacggccgctacggcgaaaacccgaaccgtctgcag
cactactatcagttccaggtcgtgctgaagccgaacccggaaaacttccaggaactgtat
ctgggctcgctcaagcacgtgggcctcgacccgctggtgcatgacattcgtttcgtcgaa
gacaactgggaatcgccaaccctgggcgcctggggcctgggctgggaagtctggctcaac
ggcatggaagtgacccagttcacctacttccagcaggcgggtggcatcgagtgctacccg
gtcaccggcgaaatcacctacggtctggaacgcttggccatgtacctgcagggcgtggat
tcggtctacgacctggtgtgggccgacggcccgttcggcaaagtgacctacggcgacgtg
ttccaccagaacgaagtggaacagtcgacctacaacttcgaacacgccaacgtcgagaag
ctgttcgaactgttcgatttctatgaaagcgaagccaagcgcctgatcgagctggaccag
ccgctgccgttgccgagctatgaaatggtgttgaaggcgtcccataccttcaacctgctg
gatgcacgccgggcgatttccgtgaccgcgcgccagcaatacatcctgcgtgtgcgcacc
ctggcgcgttccgttgcgcaagcctacctgctggcccgtgccaagctgggcttcccgatg
gcgaccccggacctgcgtgatgaagtgttggctaagctggaggctgcacaatga

DBGET integrated database retrieval system