KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1996
Entry
PSEBR_a1996       CDS       T01472                                 
Name
(GenBank) Conserved hypothetical protein
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
SSDB
Motif
Pfam: TraC_F_IV AAA_22 P-loop_TraG AAA_16 TrwB_AAD_bind T2SSE AAA_10 FtsK_SpoIIIE DUF87 AIG1 AAA_7 ATPase_2
Other DBs
NCBI-ProteinID: AEA68226
UniProt: F2KF00
Position
complement(2439770..2442607)
AA seq 945 aa
MTWFSQWKRKKESTVAAESNAWDEHIAKLAEHGISEPGLVRRRPTTEADDHAFYDLAPSF
VDRLPWVEYLPQSQCMLLEDGLSVAAFFELTPLGTEGRESTWLLQARDTLENILQDSFDE
LDNNPWVVQLYAQDETNWDGYLQTLGQYLQPRACGSAFSEFYLRFFAHHLDAISKPGGLF
EDTTLTRLPWRGQTRRVRMVVYRRVSKSVPSRREHTPEQALSIVCERLTAGLTSAGIKTQ
RMGGDKIHNWLLRWFNPNPTHLGSSTSDRDRFYQLTTYPEEVEEGEIELATGTDFAQRLF
FSQPRSDVSEGVWYFNDMPHRVMLMDRLRTPPHTGHLTGETRKGDAINTYFDQMPEDTLM
CLTLVATPQDVLEAHLNHLSKKAVGDTLASEQTRQDVHQARSIIGSSHKLYRGSLAFYLR
GKDMAQLDSRSMQLANVMLSAGLQPVREDDEVAPLNSYLRWLPCVFDPAKDKRQWYSQLM
FAQHVANLAPVWGRSQGTGHPGITLFNRGGGTLCFDPLNRLDRQMNAHLFLFGPTGSGKS
ATLNNILNQITAVYRPRLIIVEAGNSFGLFADFARRLDLTVHHVRLSPGAGVSLAPFADA
RRLVETPDEIQTLDADRLDDTALPYEGDEQRDVLGELEITARLMITGGEDKEEARLTRAD
RSLIRQSILNAAQRCASEHRTVLTQDVRDALREQGADNGLPEGRRTRLLEMAEAMDLFCQ
GLDGELFNRPGTPWPEADITIVDLATFAREGYNAQLSIAYLSLLNTVNNIAERDQFLGRP
IINVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNLDDLPKAAEPMLNMIEWWI
CLSMPPDEVEKIARFRELSPAQKALMMSARKESGKYCEGVVLSKSMEALFRAVPPSLYLA
MAMTEPEEKAARFKLMQEHKISELDAAIHMAEDIDRARGIEPLQL
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgacttggttttctcaatggaaacgtaaaaaggaatcaaccgtcgccgctgagtcaaac
gcatgggatgaacatatcgcaaagcttgccgaacatggaatttccgaacctgggctagtg
cgtagaagaccgacaactgaagccgatgatcatgcgttttatgacctggcgccgtctttt
gtcgatcgcctgccttgggtcgaatacctaccacagtcacaatgcatgctcttggaggac
gggctgtctgtcgcagccttcttcgagctaacgccactgggcactgaaggtcgtgaaagc
acttggttgctgcaagcccgagacactctggaaaacatcctgcaagacagctttgatgag
ttggacaacaatccatgggttgtacaactctacgcacaggacgaaaccaactgggatggg
tatctccagacgctgggtcagtaccttcaaccgcgagcttgtggcagtgccttcagcgag
ttttacctgcgtttctttgcacatcatctcgacgcgatctccaagcctggcgggctcttc
gaagacaccacgctgactcgcttgccttggcgcgggcagacccgacgagtacgaatggtc
gtgtacagacgcgtgtcaaaatcagtcccatcgcgccgagagcacactcccgaacaagca
ttgagcattgtttgcgagcgattgaccgctgggttgacgagcgctggtatcaagactcag
agaatgggaggcgacaagatccataactggttattgcgttggtttaaccccaacccgacg
cacctgggctcctcaacatcggatcgtgaccggttctatcaactgacgacttaccctgag
gaggtcgaagagggggaaattgagctggctaccggcacggatttcgcccaacgtctgttc
ttcagtcagccacgatctgatgtgtctgaaggcgtttggtacttcaacgatatgccccac
cgggtcatgctgatggaccgactacgcacccctccccacacgggacacctgactggtgaa
acgcgcaaaggggacgcaatcaacacatacttcgatcaaatgcctgaagacaccctgatg
tgcctgacgctggttgccactccgcaagacgtcctggaggcccacctcaatcacctgagt
aaaaaagctgttggcgatacccttgcctcggaacagacacgccaggacgtccaccaagcc
cgatcaattatcggcagttcgcacaagctttaccgaggatcactggccttctatctacgc
ggtaaggacatggcgcaattggactcccggagcatgcaattggccaatgtgatgctcagt
gctgggttacagccggtgcgcgaagatgacgaagttgcaccgcttaacagctacctgcgt
tggttaccgtgtgtcttcgacccggccaaagataagcgccagtggtacagccagctcatg
ttcgcgcaacacgttgccaatctagccccggtatggggccgcagtcagggaacggggcat
ccgggcattaccttgttcaatcgtggcggcggcactctgtgcttcgaccctctgaaccgc
cttgatcgtcagatgaatgctcatctgtttttgttcggccctacaggctccggaaaatcc
gcgacgctcaacaacattctgaaccagatcactgctgtttaccggccgcggttgatcatc
gttgaggctggtaactcctttgggctgtttgccgactttgcaagacgcctggatctgacc
gtacatcacgtcaggctatcaccaggtgccggcgtgagcctggctccctttgcagacgct
cgtcgcttggtggaaacaccggatgagattcagacgctcgacgccgaccggctggatgac
acagctctgccgtatgagggtgatgaacaacgtgatgtgttgggcgagttggagatcact
gcacgactgatgatcacaggaggtgaggacaaggaagaagcacgtcttacgcgagcggat
cgcagcctgattcgccagagcattttgaatgcggcacaacgctgtgccagtgagcaccga
acggtgctaacccaggatgttcgagatgcgctgcgtgaacaaggcgcagataacggtcta
ccggaggggcgccgtactcgtcttctggaaatggccgaagcgatggatctgttctgccag
gggttggatggagaactgttcaatcgcccaggaactccgtggccggaagccgacatcacc
attgtcgatctggccaccttcgctcgcgagggctataacgctcaactctcgatcgcgtat
ttatcgctgctcaacactgttaacaacatagccgagcgggaccagttccttggacgtcca
atcatcaacgtcaccgatgagggacacatcatcaccaagaacccgctgctggctccctat
gtcgtcaagatcaccaagatgtggcgaaagctgggggcctggttctggctggccactcag
aatctcgatgacctacccaaagccgccgaaccaatgttgaacatgattgagtggtggatc
tgcctgagcatgccgcctgatgaggtggagaagatcgccaggttccgggagctcagcccc
gctcagaaagcgctaatgatgtcggcacgaaaggagtccggaaagtactgcgagggcgtc
gtgctttcaaaatcaatggaagcgctgtttcgtgcggtacctccgagcctgtacctggcc
atggccatgaccgagccagaagaaaaagcggcacgattcaagctcatgcaagaacacaaa
atcagtgaattggacgcagcgattcatatggctgaagacatagaccgagcccgaggaatc
gaaccgctgcaactctag

DBGET integrated database retrieval system