KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2001
Entry
PSEBR_a2001       CDS       T01472                                 
Name
(GenBank) Conserved hypothetical protein; putative membrane protein
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 TniB
Other DBs
NCBI-ProteinID: AEA68237
UniProt: F2KF11
Position
complement(2448780..2450909)
AA seq 709 aa
MAQSHAVETLLRPAVELYSVAACGSAAALCLTAPWSLALSPSLGMGAAFTFAILGLVRLK
QACIVLRYRRQMRRLPRYVMTSREIPVSHQRLFVGKGFRWDQRHTHRLMQTYRPEFRKYV
EPSVSYQMARRLEARLEFASPLLMHLPRLTSLDHPLNPVRPLPPVGGLPRLHAVEPQEVD
VTLPLAERVGHTLVLGTTRVGKTRLAELFITQDIRRGEVCIVFDPKGDAELLKRMYVEAK
RADREGEFYVFHLGQPSISARYNAIGRFGRITEVASRIAGQLSGEGNSAAFREFAWRFVN
IIARALVELGQRPDYLLIQRHVINIDALFIEYSAYFFAEHEPKAWEVIVQIEAKLNEKNI
PRHMMGREKRVVAIEQYLSQARLYDPVLDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGD
IAQLLAPDYVDLEDPRPIFDWMQAIRKRAVVYVGLDALSDSEVASAVGNSMFSDLVSVAG
HIYKFGIDDGLPGASADKKIPINVHADEFNELMGDEFIPMINKGGGAGIQVTAYTQTLSD
IEARIGNRAKAGQVIGNFNNLFMLRVRETATAELLTKQLPMVEVYATSVMSAATDSSDPH
GSTAFTSNTQDRVTTTSVPMIEPAHVVALPKGQAFGLIEGGQLWKIRMPLPAPDPDEAMP
KDLQTMAGYMRKRYVAANDWWSSTAAQNPESSLPEDLLEDSSHPELSDV
NT seq 2130 nt   +upstreamnt  +downstreamnt
ttggctcagtcacatgctgttgaaacgttactaaggccagccgttgaactgtacagcgtt
gctgcatgtggttcggcggctgctttgtgtctcacagcaccttggtcactggcactttcc
ccgtctcttgggatgggggcagcatttacctttgccatcctgggtttggttcgtctgaag
caggcttgcattgtgctgcgctatcgtaggcaaatgagacgtctgccgcgctatgtgatg
accagtcgcgagataccggtcagtcatcaacgcttgtttgtcggcaaagggtttcgctgg
gatcaacgccatacccatcggctgatgcagacctaccgaccggaatttcgaaagtatgtt
gagccatcagtgtcgtatcagatggcacgtcggttggaggcgcggctggaatttgcatct
cccctgttgatgcatctgcctcgactcacaagcttggaccatccattaaatccggtcagg
ccattacctccggttggcgggcttcccaggttgcatgctgtcgaaccccaagaagtcgat
gtcacccttccgttggctgaacgagtcggccatacactggtgctaggcacgacgcgggtc
ggcaagactcggctggcggagctgtttatcacccaggacatccgccgcggcgaggtctgt
atcgtatttgatccgaagggcgatgctgagctgctcaagcggatgtacgttgaagccaag
cgtgccgatcgtgaaggcgaattctatgtattccacctgggacagccctccatctctgcc
cgctacaacgctatcggtcgtttcggacgaatcacagaggtagcgtctcgtatcgccggg
caattatcaggtgaaggcaactccgcggcctttagggagttcgcctggcgcttcgtcaac
atcattgccagggcgttggtcgaattggggcaacgaccggactacctcctaattcaacgt
catgtcatcaatatcgatgccctgttcatcgagtattccgcttacttctttgctgagcat
gagccaaaagcttgggaggtcatcgtccaaatcgaggccaagctcaacgagaagaacatt
ccaaggcacatgatggggcgagagaaacgcgtcgtcgcgatcgagcagtacctgtcccag
gcgcggctttatgatcctgtccttgatggtcttcgttccgccgtacggtatgaccgcacc
tacttcgacaaaatcgtcgcatcgcttctcccgctcttggagaagctcaccacgggtgac
atcgcccaactattggcacctgactacgtggatctggaggatccacggccgatctttgac
tggatgcaggccattcgtaaacgagcggtggtctacgttgggcttgacgccttgtccgac
tcggaagtcgcttctgccgtgggtaattcaatgttttctgacctggtatccgtcgcaggt
catatctacaaatttggtattgatgatggtctgcccggggcatcagcagacaaaaaaatc
ccaatcaatgtccatgccgatgaattcaacgaactgatgggggacgagttcatcccgatg
atcaacaaaggcggtggcgctggcatccaggtaacggcctacacccagaccctcagcgat
atagaggcgcgcattggcaatcgcgccaaggccggccaagtgatcggcaacttcaacaac
cttttcatgcttcgggttcgggaaactgcgacagccgaactgctcaccaagcaattgcct
atggtcgaggtttatgcgacctcggtgatgagcgcggccactgacagctcagatccgcac
ggctccactgccttcacatcaaatactcaagatcgggtcacgacgaccagcgttccgatg
attgaacctgcgcacgttgtggctctgccaaagggccaagcatttggattgatcgagggt
gggcagctctggaagattcgcatgcctttaccggcgccggatcctgatgaggccatgccc
aaagacctgcaaacgatggctgggtacatgcgcaaacgctacgtggcagctaatgactgg
tggagttcgacagcagctcaaaacccagagtcctccttacctgaggatcttctcgaggat
agctctcacccagagctcagcgacgtatga

DBGET integrated database retrieval system