KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2321Help
Entry
PSEBR_a2321       CDS       T01472                                 

Definition
(GenBank) 2,4-diacetylphloroglucinol biosynthesis protein
  KO
K22839  2-acetylphloroglucinol acetyltransferase [EC:2.3.1.272]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
KEGG Orthology (KO) [BR:pba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSEBR_a2321
Enzymes [BR:pba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.272  2-acetylphloroglucinol acetyltransferase
     PSEBR_a2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEA68600
UniProt: F2KGR1
Position
complement(2868748..2869944)
Genome map
AA seq 398 aa AA seqDB search
MSARRVAIVSAAYTPKPGSSRVRQTFKEMIVESAYQALNAIKMHPRELQAVAYGYHGEGI
SEYGGLGPTISDALGISPAPTFMSTANCTSSSVSFQMAHQMVASGEYDIVLCGGFEKMTD
HINYAEYIGSSTECEYDYFLGISHTDAFALATAEYFEKFGYAGREADVLATFGRQMRIYA
HNTPTATRYGVPIPSLEALKSSEACGSMLAWGEASGCAILVAEHLAHRYTTQPVFIRGCA
YTGVSHYFGTRYHNPTLQFPGLPKDVGMAVSANSMACAEIAYKKAGITAKDIDVAQVYDL
LGAGLIQMESMGACGPGQAGDFVLEGGIALDGQLPLNTDGGNIGRGHASGCDGILHITEL
FRQLRGESNNQVKGARIGVSQNLGGYAAHNSVIVLSND
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgacgcgttgctatcgtttcggctgcctatacccctaagcccggcagttcc
agagttcgtcagactttcaaggagatgatcgtcgagtccgcctaccaggcgctcaacgcc
atcaagatgcacccccgcgaactccaggcagttgcctatggctaccacggtgaaggcatt
tctgaatacggaggcctgggcccgaccatttccgatgccctgggtatcagccctgccccc
acgttcatgagtactgccaactgcaccagcagttcggtgtcgttccagatggctcaccaa
atggtcgcctcaggtgaatacgacattgtcctgtgcggcggctttgaaaaaatgaccgat
cacatcaactacgccgagtacattggctccagcactgaatgtgaatacgattattttctc
ggcatctcacacacagacgccttcgccctggcgaccgccgaatattttgaaaagttcggt
tatgcaggacgcgaggcggatgtattggcaacgtttgggcggcagatgcgtatctatgcc
cataacacccccacggctacccgctatggcgtgccgattccgtccctcgaagcactcaag
agtagcgaagcatgtggctcgatgttggcctggggtgaagccagcggttgcgccatcctg
gttgccgaacaccttgcgcaccgttacacgacccagccggtatttatccgtggctgtgcc
tacaccggcgtatcgcactatttcggcacgcgctatcacaacccgacgttgcaatttcca
gggctgccaaaagatgtaggcatggcggtttccgccaactcgatggcctgcgccgaaatc
gcctacaaaaaagccggcatcactgcaaaggatatcgatgtggcgcaagtctacgacttg
ctgggcgccgggttgattcaaatggaatccatgggcgcatgtggtccaggccaggcaggc
gactttgtattggaaggcggcatagcccttgacgggcaacttcccctgaacactgacggc
ggcaacatcggacgcggccacgcctccggttgcgatgggattttgcacattactgaattg
ttccgacagcttcgcggcgagtccaacaaccaagtcaaaggcgcccgtattggcgtctcg
caaaatctgggcggttacgccgcgcacaacagtgtcattgtgctttccaacgattaa

DBGET integrated database retrieval system