KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2939Help
Entry
PSEBR_a2939       CDS       T01472                                 

Definition
(GenBank) putative AMP-binding protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00620  Pyruvate metabolism
pba00640  Propanoate metabolism
pba00680  Methane metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a2939
   00620 Pyruvate metabolism
    PSEBR_a2939
   00640 Propanoate metabolism
    PSEBR_a2939
  Energy metabolism
   00680 Methane metabolism
    PSEBR_a2939
Enzymes [BR:pba01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSEBR_a2939
Lipid biosynthesis proteins [BR:pba01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSEBR_a2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Thiolase_C CsgA
Motif
Other DBs
NCBI-ProteinID: AEA69241
UniProt: F2KGA5
Position
complement(3623256..3624929)
Genome map
AA seq 557 aa AA seqDB search
MLVMRDYSSATSQFDYLHTVNTALHGSLEALNACVECCDRHALPGRIALFWEGRDGSDAT
WTYRDLQDNAARFANFLRAQGIGKGDKVAGLLPRTAELLIVVLATWRIGAVYQPLFTAFG
PKAIEHRLGSSGARLVVTDAVNRPKLDEVAGCPTIVTVGGEKGQGIVRGDYSFWAEVANH
SSQCEPLMLTGEDPFLLMFTSGTTGPAKALSVPLKAIVAFQNYTRDAVDLRPEDAFWNVA
DPGWAYGIYFGVTGPLAMGHPITFYDGPFTLESTCRVINKYGITNLTGSPTAYRLLIAGG
EQFARSIKGKLRIVSSAGEPLNPEVIRWFADNLNVVIHDHYGQTELGMVLCNHHGLEHPV
HLGAAGFASPGHRIVVLDENQRELGVGQPGILALDRSQSPMCWFAGYEGGPTKAFVGDYY
LSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHAAVVEAAVIGKPDPERT
ELVKAFVVLSAQYRASAELAEELRQHVRKRLAAHAYPREIEFVSDLPKTPSGKLQRFILR
NQEIAKAQEAAAQNVSA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatgcgcgattattcgtccgccacttcgcagttcgattacctgcacaccgtc
aacactgcactgcacggctcgctcgaggcgctcaatgcctgcgtagagtgttgcgaccgg
catgcgttgccagggcgcatcgccttgttctgggagggtcgtgacggcagcgatgcgact
tggacttaccgtgacctgcaggacaatgccgcgcggttcgccaatttcctgcgcgcccaa
ggcatcggcaagggcgacaaagtggccggtctgttgccgcgcaccgctgaactgctgatc
gtggtgctcgccacctggcgcattggggcagtgtatcaaccgttgttcaccgcattcggg
cccaaggccatcgagcaccgcctcggcagctcgggggcgcgcttggtcgttaccgatgcg
gtcaaccgtcccaagctcgacgaagtcgccggttgtcccaccatcgtcacggtcggcggc
gaaaagggtcagggcatcgtgcgtggcgactacagtttctgggccgaggtggcgaaccac
tccagccagtgcgaaccgctgatgctcaccggcgaagacccgttcctgctgatgttcacc
tccggcaccacaggacctgccaaggcgctgtcggtgccactcaaggccatcgttgcgttc
cagaactacacccgtgacgcggtagacctgcgtcccgaagacgccttctggaacgtcgcc
gacccgggctgggcctacggcatctattttggcgtgaccgggccgctggccatggggcat
ccgattaccttctacgatggcccgttcaccctggaaagcacctgccgggtcatcaacaaa
tacggcatcaccaacctcaccggctcgcccacggcctatcgcctgttgattgccggtggc
gagcagtttgcccgctcgatcaagggcaagctgcgcatcgtcagcagcgccggtgagcca
ttgaacccggaggtgatccgttggttcgccgacaacctgaacgtggtgatccacgaccat
tacggccagaccgaactgggcatggtgctgtgcaaccaccatgggctggaacacccggtg
cacctgggcgcggccggctttgcttcgccaggccatcggatcgtggtgctggatgaaaac
cagcgcgagctgggcgtaggccagccgggcattctcgcactggaccgcagccagtcgccc
atgtgctggttcgccggttacgaaggcgggccgaccaaggccttcgtcggtgactactac
ttgagcggcgataccgtggagctgaacccggacggcagcatcagtttcgtaggccgcagc
gacgacgtgattaccacgtccggctaccgggtcggtccgttcgacgtggaaagcgcgctg
atcgaacacgcggcggtggtggaagcggcggtgatcggcaagcctgatccggaacgcacc
gagctggtgaaggccttcgtggtactcagcgcgcagtaccgtgcctctgcggaactggcc
gaagaattgcgccagcacgtgcgcaagcgcctggcggcccatgcctatccccgtgaaatc
gaatttgtcagcgacttgccgaaaaccccaagcggcaagttgcagcgctttatcttgcgc
aaccaggaaatcgccaaagctcaagaggctgcggctcagaacgtttcagcttga

DBGET integrated database retrieval system