KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3311
Entry
PSEBR_a3311       CDS       T01472                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pba00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSEBR_a3311
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a3311
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a3311
SSDB
Motif
Pfam: ImpA_N TilS
Other DBs
NCBI-ProteinID: AEA69627
UniProt: F2K7N6
Position
complement(4092891..4093973)
AA seq 360 aa
MSLPISPLPELVSQLLEPISAESPCGPDLRYEPEYDQLRELRREDDTSLPTGVWQSSIKR
ALWPDLERLATTLLLERSKDLMISAWLGEAWLHMAGLEGLPGSLALVAGLCERYPEQLHP
QAEDGDQSWRVIPLEWLARRYSEVLLTRVPLFDGREQAFAAFSLDDWQRLQRQQVLVNDS
KNAKASAEAARNDQKKLGELIRNTPLSFWLHRQGSLMLSLQHLQRLEAWSDAYLGNLAPG
YKSLQDVMQALLTLVEEFIAMHPQQPTVAPVQTSPASTTSTSQPQAAPAQVFQEPANREE
AYRQLMVIAGYLARTEPHSPVPYLIRRGVEWGNKPLSELLGELISADAESRRLWTLLGVL
NT seq 1083 nt   +upstreamnt  +downstreamnt
gtgagcttgccgatatcgcctttgcctgagctggtcagccagttgctcgagccgatcagc
gccgaatcgccctgtggcccggacctgcgctacgaaccggaatacgaccagttgcgcgaa
ttgcgccgggaagacgacaccagcctgcccaccggcgtgtggcagtcttcgatcaagcgc
gccctgtggccagacctggaacggcttgcgaccacgttgctgcttgagcgcagcaaggac
ctgatgatcagcgcctggctgggggaggcctggctgcatatggccgggctggaggggttg
ccgggtagcctggcgctggtggcggggctgtgtgagcgctatccggagcagttgcacccc
caggccgaggacggcgaccagtcgtggcgggtgatcccgctggagtggctggcccggcgc
tacagcgaagtgctgctgacgcgggtgccgttgttcgacggccgggagcaggccttcgcc
gctttctccctggacgactggcaacgcttgcagcgccagcaagtgttggtcaacgacagc
aagaacgccaaggcctcggccgaagcggcgcgcaacgatcaaaagaaactcggcgaactg
attcgcaacacacccttgtcgttctggttgcaccgccaaggcagcctgatgttgagcctg
caacacctgcaacggctcgaagcctggagcgacgcttacctgggcaacctggccccgggc
tacaaatccctgcaggacgtgatgcaggccttgctgacactggtagaggagttcatcgcg
atgcacccacagcaacccaccgtcgcgccggtgcaaacgtccccggcatccacgacgtcg
acgtcccagccgcaggcggctccagcccaggtcttccaggaaccggccaatcgtgaagag
gcctaccgacagctaatggtcatcgccggttacctggcccgtaccgaaccccacagcccg
gtgccctacctgatccgacgcggcgtggagtggggcaacaagccgttgagtgagttgctg
ggggaactgatcagtgccgatgccgagtcccggcgcttgtggacgttattgggcgttctc
taa

DBGET integrated database retrieval system