KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3675Help
Entry
PSEBR_a3675       CDS       T01472                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00071  Fatty acid degradation
pba00350  Tyrosine metabolism
pba00625  Chloroalkane and chloroalkene degradation
pba00626  Naphthalene degradation
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a3675
  Lipid metabolism
   00071 Fatty acid degradation
    PSEBR_a3675
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSEBR_a3675
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSEBR_a3675
   00626 Naphthalene degradation
    PSEBR_a3675
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSEBR_a3675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AEA70021
UniProt: F2KIZ5
Position
complement(4514737..4515777)
Genome map
AA seq 346 aa AA seqDB search
MKAVVYEAFSQPPRLMTVEDPTAERHGVVVQVLGTGVCRSDWHGWKGHDPDIRLPHVPGH
ELAGIVAEVGRDVTRWKVGDRVTVPFVGGCGACPECNSGNQQVCHSQFQPGFTHWGSFAE
YVGIHKADLNLVALPENMDFATAASLGCRFVTSFRAVVDQGKVSAGQWVAVHGCGGVGLS
AVMIANAIGANVIAIDICDDKLKLAQSLGAVATVNASRVADVTEAVLEITKGGAHVSLDA
LGHPTTCFNSINNLRRRGRHVQVGLMLADQSTPAIPMSKVIAYELEICGSHGMQAHRYGA
MMEMITSGKLAPDKLVGKTISLEQSIDALMNMDRFDTAGVTVVTEF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagtttacgaagccttttcccaacccccgcgtttgatgactgtcgaagac
ccgaccgccgagcgtcacggtgtggtggttcaggtccttggcacgggcgtctgtcgaagc
gactggcatggctggaaaggtcatgatcctgacatccggctgccccacgtgcccggtcac
gaattggcagggatcgtggcggaggtgggtcgggatgtcactcggtggaaggtgggcgat
cgcgtcaccgtgccttttgtcggtggctgtggggcgtgcccggaatgcaatagcggcaac
cagcaggtgtgccacagccagtttcagccgggcttcacccattggggttctttcgccgag
tacgtggggattcacaaggcggatttgaatctggtcgcgctgcctgaaaacatggatttc
gccacggcggcgagcctgggctgtcggttcgtcacctcgttccgcgcggttgtcgatcaa
ggcaaggtctcggcgggccaatgggtggcggttcatggctgtggcggtgtggggttgtcc
gcggtaatgatcgccaacgctatcggggcgaacgtcatcgccatcgatatctgcgacgac
aagctcaagcttgcccagtcgcttggtgccgttgcgacggtcaacgcaagccgcgtggcg
gatgtgaccgaggcggtactcgagattacgaagggcggcgctcatgtttcgctggatgcc
ctgggccatccaacgacctgcttcaactccatcaataatctgagacggcgcggcaggcac
gtccaggtcggtttgatgctggcggaccagagcacgccggcaatccccatgagcaaggtc
attgcctacgagctggagatctgtggcagccatggcatgcaggctcaccgttacggcgcg
atgatggagatgatcacgtccggcaaactggcgcctgacaaattggtcggcaagaccatc
agcctcgaacaatccattgatgcgctcatgaacatggatcggtttgacacggcaggggtg
acggtcgtgacggagttctag

DBGET integrated database retrieval system