KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4311Help
Entry
PSEBR_a4311       CDS       T01472                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00260  Glycine, serine and threonine metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSEBR_a4311
Enzymes [BR:pba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PSEBR_a4311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP DUF4031 RraB ASL_C
Motif
Other DBs
NCBI-ProteinID: AEA70719
UniProt: F2KC66
Position
complement(5252005..5253009)
Genome map
AA seq 334 aa AA seqDB search
MSVIDLRSDTVTQPTAGMLDAMASAPTGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPLEVQADGTLDLAHVAA
AIKPDDFHFARTRLLALENTMQGKVLPLEYLARARRFTQEHGLALHLDGARLYNAAVKLN
VDAREITQYFDSVSVCLSKGLGAPVGSVLCGSAELIGKARRLRKMVGGGMRQAGILAAAG
LYALEHQVQRLADDHANAQRLAEGLRAAGYEVEPVQTNMVYVQMGERAEAIKAFADERGV
KLSAAPRLRMVTHMDVSAAQIDQVIATFVEFSRH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttatcgatcttcgcagcgacacggtcacccaacctaccgccggcatgctggac
gccatggccagcgcgcctaccggcgacgatgtgtatggggaagacccgaccgtcaatcgc
ctcgaggccgaactggccgcgcgcttggggtttgccgcagcgctgttcgtgcccacgggg
accatgagcaacctgttgggtttgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcccacacctacaaatacgaaggcggcggtgcggccgtgctcggttcgatc
cagccccagccccttgaagtgcaggcggacggtaccctggacctggcgcatgttgctgcg
gcgatcaaacccgatgatttccactttgcccgcacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccactggaatacctggcccgggcccggcgtttcacccaggaa
catggcctggccctgcacttggacggggcgcggttgtacaacgctgcggtcaagctgaat
gtcgatgcccgtgagatcacgcagtacttcgattcggtgtcggtgtgcttgtccaagggc
ctcggcgcgccggtgggctcggtcctgtgtggcagcgccgaactgataggcaaggcccgc
cggctgcgcaagatggtcggtggcggcatgcgccaggcggggattctcgcggcggcgggg
ctatacgccctggaacatcaggtccagcgcctggccgatgaccacgccaatgcccagcgg
ctcgccgagggcttgcgtgcggcgggttatgaagtcgagccggtgcagaccaacatggtc
tacgtgcaaatgggcgagcgggccgaggcgatcaaggcatttgccgatgaacggggcgtc
aagctcagcgcggcgccacgcctgcgaatggtgacgcacatggacgtgagcgcggcgcaa
atcgaccaggtgatcgccactttcgtcgaattttcccgccactga

DBGET integrated database retrieval system