KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4694Help
Entry
PSEBR_a4694       CDS       T01472                                 

Definition
(GenBank) Putative maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00350  Tyrosine metabolism
pba00643  Styrene degradation
pba01100  Metabolic pathways
pba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    PSEBR_a4694
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    PSEBR_a4694
Enzymes [BR:pba01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     PSEBR_a4694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Tom37 GST_C
Motif
Other DBs
NCBI-ProteinID: AEA71112
UniProt: F2KL71
Position
complement(5698484..5699122)
Genome map
AA seq 212 aa AA seqDB search
MELYTYYRSTSSYRVRIALALKGLDYQALPVNLIAAPGGEHRQPAYLAINPQGRVPALRT
DEGALLVQSPAIIEYLEERYPQVPLLSADLAMRAHERGVAALIGCDIHPLHNVSVLNKLR
QWGHDETQVTEWIGHWISQGLAAVEQLIGDDGYCFGAAPGLADVYLIPQLYAAERFNVSL
LAYPRIRRVAALAAGHVAFQQAHPAKQPDTPA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggaactctatacctactatcgctccacctcgtcctatcgggtgcgcattgcactggcg
ctcaagggcctggattaccaggccctgccggtcaacctgatcgctgcgcctgggggcgag
catcgccagccggcctatctggcgatcaacccccagggccgggtgccggcgctgcgcacc
gatgagggcgcgctgctggtgcaatcgccggccatcatcgaatacctggaggagcgttat
ccacaggtgccgctgctcagcgccgacctggcgatgcgcgcccacgaacgaggcgtcgcc
gcgctgatcggttgcgacattcaccccctgcacaacgtcagcgtgctcaacaaactgcgg
cagtggggccacgatgaaacgcaggtgacggagtggatcggccactggatcagccagggc
ttggcggcggtggagcagttgattggcgacgacggctattgcttcggtgcagcgccgggg
ctggcggatgtatacctgatcccgcagttgtacgcggccgagcggttcaatgtttcgttg
ctggcgtatccgcggatccgtcgtgttgcggcgttggcggctgggcatgtggcgttccaa
caggcgcacccggcgaagcagccggataccccggcctga

DBGET integrated database retrieval system