KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5553
Entry
PSEBR_a5553       CDS       T01472                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSEBR_a5553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5553
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a5553
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: AEA72083
UniProt: F2K706
Position
complement(6695896..6697206)
AA seq 436 aa
MSNDDRTQFMPTPGGRGGDPFRPDAGRPQPTPAPAPLSMPAAPVLTGKAEGLNPLESAAG
PLLALLTRLRNTIAHPAPASLRAQLLAYLRQFEERAEAAGVVRNDVLLARYALCTALDEA
VLSTPWGGTSDWGKQSLLITVHNEAWGGEKVFQLLEHCLQSPRERLYLLELLYLCMCLGF
EGRYRVMNDGRSQLEALRERTAAVIRSARGDYERELSPHWRGVTVARDRLAQFMPPWIAV
AIGAALLLALLFGLRMKLASDAEPVFKNIHFLGEIPVQTIDRPVVQPKVIERPRLAGFLA
DEIRANRIAVEDAVDRSVVTIRGDELFASGSASIKDDFQPLMLRIADAVRKVKGQVLVTG
HSDNRPIATLRFPSNWALSEARAQSVLQILSAKTGQPERFSAEGRSDTEPLASNATTEGR
ARNRRVEITVLAEGVE
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagtaacgacgatcgtacccagttcatgccgacgcccggtggccgtggtggagatccc
ttccgcccggacgctggccggccacagccgacgcctgcgcctgcaccgctgtcgatgccg
gccgcgccggtgctgaccggcaaggccgaggggctcaacccgctggaaagcgccgccggc
ccgctgctggcgctgctgacgcgcctgcgcaacaccattgcccacccggcgccggccagt
ctgcgcgcacaactgctggcctacctgcgccagttcgaagagcgtgccgaggccgccggt
gtggtacgcaacgatgtgttgctggcccgctacgccttgtgtaccgcgctggacgaagcg
gtgttgagcacgccgtggggcggcaccagcgattggggcaagcagagcctgttgatcacc
gtgcacaacgaagcctggggcggtgagaaggtgttccagttgctggagcattgcctgcaa
agcccgcgcgagcgcctgtatctgctggagcttttgtatctgtgcatgtgcctgggtttc
gaagggcgctatcgggtgatgaacgacggtcgcagccaactggaagcgttgcgtgagcgc
accgccgccgtcatccgcagcgcccgtggcgactacgagcgcgagctgtcgccgcactgg
cgcggtgtcactgtggcccgtgatcgactggcgcaattcatgccgccatggatcgccgtg
gccatcggtgcggcgctgttgctggcgctgctgttcggcctgcgcatgaagctggcctcc
gatgccgagccggtgttcaagaacattcatttcctcggtgaaatcccggtgcagaccatc
gaccgccctgtggtacaaccgaaggtgatcgagcgcccacgcctggccggtttcctcgcc
gatgaaatccgcgccaaccgcattgccgtggaagacgccgtcgaccgctcggtggtgacc
atccgcggcgatgagctgttcgcctcgggcagcgccagcatcaaggacgatttccagccg
ctgatgctgcgcatcgccgatgcggtgcgcaaggtcaagggccaggtcctggtcaccggg
cacagcgataatcggccgatcgccaccctccggttcccgtccaactgggcgttgtccgaa
gcgcgggcgcaatcggtgctgcaaattctctcggccaagactggccagcccgagcgcttc
agcgccgaaggccgcagcgacaccgagccgttggcatccaacgccaccacagaggggcgt
gcgcgcaaccgtcgggttgaaatcacagtattggcggagggggtcgagtga

DBGET integrated database retrieval system