KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5560Help
Entry
PSEBR_a5560       CDS       T01472                                 

Definition
(GenBank) hemolysin co-regulated protein; type VI secretion system effector
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba02025  Biofilm formation - Pseudomonas aeruginosa
pba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSEBR_a5560
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSEBR_a5560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5560
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a5560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AEA72090
UniProt: F2K713
Position
6704439..6704927
Genome map
AA seq 162 aa AA seqDB search
MAVDIFIKIGDIKGESMDKAHKDEIDVLNWSWGMSQSGNMHVGSGGGAGKVNVQDLSLTK
YVDKASPNLMMHCASGKHIDKVKLTVRKAGGESQVEYMIINLEEVLVTSLSTGGSGGDDR
LTENVTLNFAKVLVDYQPQKADGTKEGGPVKFGWNIRQNVKV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgatattttcatcaagattggcgacatcaagggcgagtccatggacaaggcc
cacaaggacgagatcgatgtcctgaactggagctggggcatgtcccagtccggcaacatg
cacgtgggcagcggcggtggtgcgggcaaggtcaacgtccaggacctgtccctgaccaag
tacgtcgacaaggcgtcgccgaacctgatgatgcactgcgccagcggcaagcacatcgac
aaggtcaagctgaccgtgcgcaaggccggcggtgaaagccaggtcgagtacatgatcatc
aacctggaagaagtgctggtcacttccctgagcaccggcggctcgggcggcgatgatcgc
ctgactgaaaacgtcaccctgaacttcgccaaggtgctggtggactaccagccacagaaa
gccgacggcaccaaggaaggcggtccggtcaagttcggctggaacatccgtcagaacgtc
aaggtgtaa

DBGET integrated database retrieval system