KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5563
Entry
PSEBR_a5563       CDS       T01472                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
KEGG Orthology (KO) [BR:pba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5563
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a5563
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AEA72093
UniProt: F2K716
Position
6705904..6706416
AA seq 170 aa
MVTEIATRDRLQPSLLDRLTDDDPTNPKESADKRVLSLTQLKASVLRDLAWLLNTTSLLS
ADATLHTPAGTSVVNFGLPALAGNSASNVDVSALETLIHQAIATFEPRILRHTLRVRARA
TAEMNHNALSFEIEGDLWAQPVPLRLMLQTDLDLETGHVRVVNADQRRRS
NT seq 513 nt   +upstreamnt  +downstreamnt
ttggtaaccgaaatcgccacccgcgatcgccttcaaccgtccctgctggaccggttgacc
gacgacgatccgaccaacccgaaggaaagcgccgacaagcgcgtgctctccctgacccaa
ttaaaagcctcggtgctgcgtgacctggcgtggctgctcaacaccacctcattgctcagc
gccgatgccacgctgcataccccggcgggcacgtcggtggtgaatttcgggctgccggca
ctggccggcaacagcgcgtcgaacgtcgatgtctcggccctggaaaccttgatccaccag
gccattgccaccttcgaaccgcgaatcctgcgccacaccctgcgagtgcgcgcccgagcg
acggccgagatgaaccacaatgcgttgagtttcgagatcgaaggcgatctctgggcgcag
ccggtgccgctgcgcctgatgctgcaaaccgacctggacctggaaaccggccatgtgcgc
gtggtcaacgccgaccagcggagacgctcatga

DBGET integrated database retrieval system