KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5564
Entry
PSEBR_a5564       CDS       T01472                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
KEGG Orthology (KO) [BR:pba00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5564
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a5564
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEA72094
UniProt: F2K717
Position
6706413..6708272
AA seq 619 aa
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARV
QLKLDAEYPTFTHNLLEIAYPHYLAPTPSMTVVQLQADPDEGSLSSGFPLPRDTVLRAAL
GRETQTCCEYRTAHAVTLWPLQVSQAEYFGNPSAVLGRLAASEPKAKAGLRLTLRTGAEL
PFNSLALDNLPLYLSGADEQPFRLYEQLLGNACAVFARKPGGDWVERLPQDALRSRGFDD
ADAALPVVPRAFQGYRLLQEYFALPHRFLFVDFTQLSRAVKRCDGQELELIVLFDRHDPS
LEGSVGASQFLPFCTPAINLFPKRLDRIHLSDRVNEHHVIADRTRPMDFEVHSLNGLTGH
GTGPEQPFLPFYAVRDPSRYGRDQAYYTVRREPRVLSSDQRRNGPRSTYIGSETFVSLVD
SQQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVGAVRCVAGPSRPRAS
HAHDAKAWRLISQLSLNYLSLSEQGQGAAALRELLRLYGDSNDAALQLQIEGLREVSSKA
CTRRLPMPGPIVFGRGLEITLEFDENAFRGTGVFLLGAVFERFLARYVSINSFTETVIRT
TERGEIMRWKAKPGRRPTL
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaatccacgcctgctggaactgtacaaccaggaactgcaccacgtgcgcgaaagcgcg
gcggagttcgccaaggaatacccgaagatcgccagtcggctgacgttgtccggcatggac
tgcgccgacccgtatgtcgagcgcctgctggaaggcttcgcctacctgacggcacgagtg
cagctcaagctcgacgccgagtacccgaccttcacccacaacctgctggaaatcgcctac
ccgcattacctggcgccgacgccgtcgatgacggtggtgcaattgcaggccgacccggac
gaaggctcgctgagcagtggtttcccgctgccgcgcgatacggtcctgcgtgccgccctg
gggcgtgaaacccagacctgctgcgagtaccgcaccgcccacgcggtgacgttgtggccg
ttgcaggtcagccaggccgagtacttcggcaacccgtccgccgtgctcgggcgcctggcc
gccagcgaaccgaaagccaaggccggcctgcgcctgaccctgcgcaccggcgccgaactg
ccgttcaacagcctggccctggacaacctgccgctgtacttgagcggtgccgacgaacag
cccttccgcctctacgaacaactgctgggcaatgcctgcgcggtgttcgcccgcaagccc
ggcggcgactgggtggagcggctgccgcaggatgcgttgcgctcgcgcggcttcgacgat
gccgacgccgcgctgccggtggtgccgcgggccttccagggctatcgcctgttgcaggaa
tatttcgccctgccccaccgtttcctgttcgtcgacttcacccagctgagccgcgcggtc
aagcgttgcgacggccaggagctggagctgatcgtgctgttcgaccgtcacgatccgagc
ctggaaggcagcgtcggcgcttcgcagttcctgccgttctgcaccccggccatcaacctg
tttcccaagcgcctggaccgcattcacttgtcggatcgggtcaacgaacaccacgtgatc
gccgaccgtacccggccgatggatttcgaagtgcattcgctgaacggcctcaccggccac
ggcaccgggccggagcaaccgttcctgccgttctacgccgtacgcgatccgtcccgttat
ggccgcgaccaggcctattacaccgtgcggcgcgaaccgcgcgtgctgtccagcgaccag
cgacgcaacggcccgcgctcgacctacatcggcagcgagaccttcgtcagcctggtggac
agccagcaagcgccctatcgccacgacctgcgccaactgggcgtgaccgctctgtgcacc
aaccgcgacctgccgctgttcatgagcgtgggcaacggcaagaccgacttcaccctcgcc
gacagtgcgccggttggcgccgtgcgctgcgtggccgggcccagtcgcccacgggccagc
catgcccacgacgccaaggcctggcggctgatcagccagttgtcgctgaactacttgtcg
ttgagcgaacaaggccaaggcgcagccgccctgcgtgaactgctgcgcctgtacggcgac
agcaacgacgcggcgctgcagttgcagatcgaaggcctgcgcgaagtcagcagcaaagcc
tgcacccggcgcttgccgatgcctggcccgatcgtgtttggtcgcggcctggagatcacc
ctggaattcgatgaaaacgcgtttcgcggcaccggggtgttcctgctcggcgcggtgttc
gagcgcttcctggcacgctacgtgtcgatcaacagttttaccgagacggtgatccgtacc
accgaacgcggcgagatcatgcgatggaaagccaagcccggacgtcgtccgaccctgtga

DBGET integrated database retrieval system