KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5567
Entry
PSEBR_a5567       CDS       T01472                                 

Definition
(GenBank) putative type VI secretion system, Vgr family
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSEBR_a5567
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5567
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PSEBR_a5567
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Sarcoglycan_1
Other DBs
NCBI-ProteinID: AEA72097
UniProt: F2K720
Position
6712142..6714079
AA seq 645 aa
MLFNQASRLAKITSPLGPEVLLLKDMGGGEELGRLFNYELQLHSLDNAIDLNQVLGKPMC
VSLQLDGGGERYFHGIVARFSQNVDQGQFASYQATLRPWFWLLTRTSDCRIFQNLTIPQI
IKQVFRDLGFSDFEDALSRPYREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQGRHVL
VLADAYGAHTTAPGYGSVPYYPKNEQQRERDHIHDWHLAQEVQPGSLELNDYDFQRPSAR
IDVRSAMPRPHTAGDYPLYDYPGTYVQSQDGEHYARTRIEALQTQHEQVELAGNARGLGS
GHLFSLTGFSRQDQNREYLIVGARYYLSQESGETGGGAPTAQFESSLTCIDAQQSYRPLP
ITHRPIVKGPQTALVVGPKGEEIWTDQFGRVKVHFYWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGG
TPANFNEIRMEDKKGAEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVTIGNNRL
RIVKQEDILSVGQRKTDSISQSYVIEVGENLRLVCGESILELNASGQINLTGVQISFYAS
GDAEFNTGGVLHLNNGGGPGATPDGQGVKGSIDANIQAAFPAPKG
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgttattcaaccaagcctcacgcctggccaagatcaccagccccctgggacctgaggta
ctgctgctcaaggacatgggcggcggcgaagaactggggcggctgttcaactatgagttg
cagctgcactcgctggataacgccatcgacctcaatcaggtgctcggcaagcccatgtgc
gtgagcctgcaactcgatggcggtggcgagcgttatttccatggcatcgtggcccgtttc
agccagaacgtcgaccagggccagttcgccagttaccaggccaccctgcgcccgtggttt
tggctgctgacccgtacctccgattgccggattttccagaacctcaccatcccgcagatc
atcaagcaggtgttccgcgacttgggcttttccgatttcgaagacgccctgagccggcct
tatcgcgagtgggaatactgcgtgcagtatcgcgagaccagtttcgacttcgtcagccgc
ttgatggagcaggaagggatctactacttcttccgccatgagcaaggtcgacatgtgctg
gtgctggccgacgcttatggagcccacaccacggcgcccggctacggctcggtgccctac
taccccaagaacgagcagcagcgcgagcgtgaccacatacacgactggcacctggcccag
gaagtccagcccggctcgctggagctcaacgactacgacttccaacgccccagcgcacgc
atcgacgtacgctcggccatgccccgcccacacactgccggcgactatcccctgtacgac
taccctggcacctacgtgcagagccaggacggcgaacactacgcccgcacccgcatcgaa
gccttgcagacccagcacgaacaggtcgaactggccggcaacgcccgcggcttgggttcg
gggcacctgttcagcctcaccggcttcagccgccaggaccagaaccgcgaatacctgatc
gtcggcgcccgctactacctctcccaggaaagcggcgaaaccggcggcggcgcgccgaca
gcacagttcgaaagcagcctgacctgcatcgacgcccagcaaagctatcggccgctgccc
atcacccatcgccctatcgtcaagggcccgcagactgccttagtggtgggtcccaagggc
gaggaaatctggaccgatcagttcggccgagtgaaggtgcacttctattgggatcggcac
gaccagtccaacgaaaacagctcgtgctggattcgcgtgtcgcaggcatgggccgggaaa
aactggggctcgatgcagatcccgcgcattggccaggaagtgatcgtcagtttcctcgaa
ggcgacccggatcggccgatcatcaccggtcgcgtctacaatgccgaacagaccgtgccc
tatgacttgcccgccaatgccacccagagcgggatgaaaagccgttcgagcaagggcggc
acgccggcgaatttcaacgaaatccgcatggaagacaagaaaggcgccgagcaactgtac
atccacgccgagcgtaaccaggacatcgtggtcgaggtggatgaaagccactcggtgggc
cacgaccgcaacaagagcatcggccacaacgagacggtgaccatcggcaacaaccgcctg
cgcatcgtcaagcaggaggacatcctctccgtcggccagcgcaagaccgacagcatcagc
cagagctacgtgattgaagtgggcgaaaacctgcgcctggtgtgcggcgaaagcatcctg
gagctcaacgccagcggccagatcaacctgaccggcgtacagatcagcttctacgccagc
ggcgatgccgagttcaacaccggcggcgtgctgcacctgaacaacggcggcggccccgga
gccacgccggacggccagggcgtcaagggcagcatcgatgccaacatccaagccgcgttc
cctgcacccaagggctaa

DBGET integrated database retrieval system