KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a652Help
Entry
PSEBR_a652        CDS       T01472                                 

Definition
(GenBank) Putative acetyl-CoA C-acyltransferase (3-ketoacyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00071  Fatty acid degradation
pba00072  Synthesis and degradation of ketone bodies
pba00280  Valine, leucine and isoleucine degradation
pba00310  Lysine degradation
pba00362  Benzoate degradation
pba00380  Tryptophan metabolism
pba00620  Pyruvate metabolism
pba00630  Glyoxylate and dicarboxylate metabolism
pba00640  Propanoate metabolism
pba00650  Butanoate metabolism
pba00900  Terpenoid backbone biosynthesis
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
pba01200  Carbon metabolism
pba01212  Fatty acid metabolism
pba02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSEBR_a652
   00630 Glyoxylate and dicarboxylate metabolism
    PSEBR_a652
   00640 Propanoate metabolism
    PSEBR_a652
   00650 Butanoate metabolism
    PSEBR_a652
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PSEBR_a652
   00072 Synthesis and degradation of ketone bodies
    PSEBR_a652
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSEBR_a652
   00310 Lysine degradation
    PSEBR_a652
   00380 Tryptophan metabolism
    PSEBR_a652
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSEBR_a652
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSEBR_a652
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSEBR_a652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pba04147]
    PSEBR_a652
Enzymes [BR:pba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSEBR_a652
Exosome [BR:pba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSEBR_a652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEA66800
UniProt: F2KDM2
Position
811999..813276
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIIGGNRIPFARSNGAYATASNQAMLTAALEGLIERYNLHGLHIGEVAAGAVL
KHSRDMNMTRECVLGSRLSPMTPAYDVQQACGTGLETVLLVANKIALGQIDSGIAGGVDT
TSDAPIAVNEGLRRILLQANRAKTTADKIKTFLQLRPQHLVPDLPRINEPRTGLNMGEHC
ELMAQTWQIPREAQDQLALESHQKMAASYAEGWQNDLMTPFLGLTRDNNLRPDLTPEKLA
SLKPAFEKSAKGTMTAGNSTPLTDGASLVLLGSEEWAKARGLPILAYLRDGETAAVDFVN
GAEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDPDYCKTRLGLD
APLGSIDRSRLNVKGSSLAAGHPFAATGGRIVANLAKLLDAAGRGRGLISICAAAGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacacaactacgccgcgtcgcgatcatcggtggtaaccgcattccgttcgcccgctcc
aacggggcctatgccaccgccagcaaccaggcgatgttgacggcagccctcgaggggctg
atcgaacgctacaacctgcatggcttgcacatcggtgaagtggctgccggtgcggtgctc
aagcactcccgcgatatgaacatgacccgcgaatgcgtgcttggctcgcggctgtcaccg
atgacgccggcctatgacgtacaacaggcctgtggcaccggattggagacagtgctgctg
gtggccaacaagattgccctggggcagatcgacagcggcattgccggcggcgtcgacacc
acctcggatgcgccgatcgcggtcaatgaagggctgcgcaggatcctgctgcaagccaat
cgcgccaagaccaccgcggacaagatcaagaccttcctgcagctgcgcccccagcacctg
gtccccgacctgccgcgcatcaatgaaccgcgcaccggcctgaacatgggtgagcattgc
gagttgatggcccagacctggcagatcccccgggaggcgcaagaccaactggccctggaa
agccatcagaaaatggccgcgtcctatgccgaaggttggcagaacgacttgatgacaccg
ttccttggcctgacccgggacaacaacctgcgcccggacctgaccccggaaaaactcgcc
tccctcaagccggccttcgaaaaaagcgccaagggcacgatgaccgcgggtaattccacg
ccattgaccgatggtgcttcgttggtgctgctgggcagcgaagagtgggccaaggcccga
ggcctgccgattctggcgtacctgcgcgacggtgaaacggcggcggtggatttcgtcaat
ggcgccgaagggctgttgatggccccggtctacgccgtgccgcgattgctggcgcgcaac
ggtttgaccttgcaggactttgattactacgagatccatgaagcgttcgccgcccaggtg
ttgtgcacattgaaggcctgggaagacccggactactgcaagacccgcctggggctcgac
gcaccgctagggtccatcgaccgcagccggttgaacgtcaagggcagttccctggccgcc
gggcacccgtttgccgccacgggcgggcgcattgtcgccaacctcgccaagttgctcgat
gccgccgggcgaggtcgcggcttgatttccatctgcgccgcagcgggccagggggtgacg
gcgattatcgagcgctga

DBGET integrated database retrieval system